UTS2 Antibody - #DF7281
| Product: | UTS2 Antibody |
| Catalog: | DF7281 |
| Description: | Rabbit polyclonal antibody to UTS2 |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 14kDa; 14kD(Calculated). |
| Uniprot: | O95399 |
| RRID: | AB_2839220 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7281, RRID:AB_2839220.
Fold/Unfold
PRO1068; U-II; UCN2; UII; Urotensin 2 preproprotein isoform a; Urotensin 2 preproprotein isoform b; Urotensin II; Urotensin-2; UTS2; UTS2_HUMAN; UTSII;
Immunogens
A synthesized peptide derived from human UTS2, corresponding to a region within C-terminal amino acids.
- O95399 UTS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Research Backgrounds
Highly potent vasoconstrictor.
Secreted.
Brain specific.
Belongs to the urotensin-2 family.
References
Application: WB Species: Rat Sample: liver tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.