Product: UTS2 Antibody
Catalog: DF7281
Description: Rabbit polyclonal antibody to UTS2
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Rat
Mol.Wt.: 14kDa; 14kD(Calculated).
Uniprot: O95399
RRID: AB_2839220

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
UTS2 Antibody detects endogenous levels of total UTS2.
RRID:
AB_2839220
Cite Format: Affinity Biosciences Cat# DF7281, RRID:AB_2839220.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

PRO1068; U-II; UCN2; UII; Urotensin 2 preproprotein isoform a; Urotensin 2 preproprotein isoform b; Urotensin II; Urotensin-2; UTS2; UTS2_HUMAN; UTSII;

Immunogens

Immunogen:

A synthesized peptide derived from human UTS2, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O95399 UTS2_HUMAN:

Brain specific.

Description:
This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene.
Sequence:
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV

Research Backgrounds

Function:

Highly potent vasoconstrictor.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Brain specific.

Family&Domains:

Belongs to the urotensin-2 family.

References

1). Urantide prevents CCl4‑induced acute liver injury in rats by regulating the MAPK signalling pathway. Molecular Medicine Reports, 2021 (PubMed: 34328202) [IF=3.4]

Application: WB    Species: Rat    Sample: liver tissue

Figure 3. Expression levels of UII and GPR14 in ALI livers was attenuated following urantide administration. Relative (A and B) gene (C) and protein expression levels of UII and GPR14 were measured via RT-qPCR and western blotting, respectively. Relative protein expression of (D) UII and (E) GPR14. The data are presented as the mean ± SEM. For RT-qPCR, western blotting and morphological analysis, n=6 per group. *P<0.05 and **P<0.01 vs. control; ^^P<0.01 vs. ALI model; #P<0.05 and ##P<0.01 vs. MgIG. UII, urotensin II; GPR14, receptor G protein-coupled receptor 14; RT-qPCR, reverse transcription PCR; MgIG, magnesium isoglycyrrhizinate; ALI, ALI, acute liver injury.

2). Urantide alleviates atherosclerosis-related liver and kidney injury via the Wnt/β-catenin signaling pathway in ApoE(-/-) mice. Herz, 2023 (PubMed: 37985514) [IF=1.1]

3). Urantide alleviates atherosclerosis-related liver and kidney injury via the Wnt/β-catenin signaling pathway in ApoE(-/-) mice. Herz, 2024 (PubMed: 37985514) [IF=1.1]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.