MOG Antibody - #DF7294
| Product: | MOG Antibody |
| Catalog: | DF7294 |
| Description: | Rabbit polyclonal antibody to MOG |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 28kDa; 28kD(Calculated). |
| Uniprot: | Q16653 |
| RRID: | AB_2839233 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7294, RRID:AB_2839233.
Fold/Unfold
BTN6; BTNL11; MGC26137; MOG alpha 5; MOG alpha 6; MOG AluA; MOG AluB; MOG; MOG Ig AluB; MOG_HUMAN; MOGIG2; Myelin oligodendrocyte glycoprotein; Myelin-oligodendrocyte glycoprotein; NRCLP7;
Immunogens
A synthesized peptide derived from human MOG, corresponding to a region within C-terminal amino acids.
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
- Q16653 MOG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.
(Microbial infection) Acts as a receptor for rubella virus.
Cell membrane>Multi-pass membrane protein.
Cell membrane>Multi-pass membrane protein.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Single-pass type I membrane protein.
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.