SERPINB3 Antibody - #DF7335

Product: | SERPINB3 Antibody |
Catalog: | DF7335 |
Description: | Rabbit polyclonal antibody to SERPINB3 |
Application: | WB IHC |
Reactivity: | Human, Rat |
Mol.Wt.: | 44kDa; 45kD(Calculated). |
Uniprot: | P29508 |
RRID: | AB_2839273 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7335, RRID:AB_2839273.
Fold/Unfold
HsT1196; Protein T4 A; Protein T4-A; SCC; SCCA; SCCA PD; SCCA-1; SCCA-PD; SCCA1; SCCAPD; Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 3; Serpin B3; Serpin peptidase inhibitor clade B (ovalbumin) member 3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SERPINB3; SPB3_HUMAN; Squamous cell carcinoma antigen 1; T4 A; T4-A; T4A;
Immunogens
A synthesized peptide derived from human SERPINB3, corresponding to a region within C-terminal amino acids.
- P29508 SPB3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Research Backgrounds
May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).
Cytoplasm.
Note: Seems to also be secreted in plasma by cancerous cells but at a low level.
Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
Belongs to the serpin family. Ov-serpin subfamily.
Research Fields
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.