NUDT1 Antibody - #DF7359

Product: | NUDT1 Antibody |
Catalog: | DF7359 |
Description: | Rabbit polyclonal antibody to NUDT1 |
Application: | WB IHC IF/ICC |
Cited expt.: | WB, IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 22kDa; 23kD(Calculated). |
Uniprot: | P36639 |
RRID: | AB_2839297 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7359, RRID:AB_2839297.
Fold/Unfold
2-hydroxy-dATP diphosphatase; 7 8 dihydro 8 oxoguanine triphosphatase; 7; 8 oxo 7 8 dihydrodeoxyguanosine triphosphatase; 8 oxo 7 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; 8-dihydro-8-oxoguanine triphosphatase; 8-oxo-dGTPase; 8ODP_HUMAN; MTH 1; MTH1; MutT human homolog 1; Nucleoside diphosphate linked moiety X motif 1; Nucleoside diphosphate linked moiety X type motif 1; Nucleoside diphosphate-linked moiety X motif 1; Nudix (nucleoside diphosphate linked moiety X) type motif 1; Nudix hydrolase 1; Nudix motif 1; Nudix type motif 1; NUDT 1; Nudt1;
Immunogens
A synthesized peptide derived from human NUDT1, corresponding to a region within the internal amino acids.
Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.
- P36639 8ODP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Antimutagenic. Plays a redundant role in sanitizing oxidized nucleotide pools, such as 8-oxo-dGTP pools. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA (By similarity).
The N-terminus is blocked.
Cytoplasm>Cytosol. Mitochondrion matrix. Nucleus.
Note: Mostly present in cytosol (PubMed:7782328). A minor proportion is mitochondrial (PubMed:7782328). A very small amount of the protein is associated with nuclei (PubMed:7782328). Variant Met-124 has decreased efficiency in translocation to mitochondria (PubMed:16607562).
Mitochondrion matrix.
Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.
Belongs to the Nudix hydrolase family.
References
Application: WB Species: Mouse Sample:
Application: IF/ICC Species: Mice Sample: hippocampus tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.