Product: NUDT1 Antibody
Catalog: DF7359
Description: Rabbit polyclonal antibody to NUDT1
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus
Mol.Wt.: 22kDa; 23kD(Calculated).
Uniprot: P36639
RRID: AB_2839297

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(92%), Bovine(92%), Horse(100%), Sheep(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
NUDT1 Antibody detects endogenous levels of total NUDT1.
RRID:
AB_2839297
Cite Format: Affinity Biosciences Cat# DF7359, RRID:AB_2839297.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2-hydroxy-dATP diphosphatase; 7 8 dihydro 8 oxoguanine triphosphatase; 7; 8 oxo 7 8 dihydrodeoxyguanosine triphosphatase; 8 oxo 7 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; 8-dihydro-8-oxoguanine triphosphatase; 8-oxo-dGTPase; 8ODP_HUMAN; MTH 1; MTH1; MutT human homolog 1; Nucleoside diphosphate linked moiety X motif 1; Nucleoside diphosphate linked moiety X type motif 1; Nucleoside diphosphate-linked moiety X motif 1; Nudix (nucleoside diphosphate linked moiety X) type motif 1; Nudix hydrolase 1; Nudix motif 1; Nudix type motif 1; NUDT 1; Nudt1;

Immunogens

Immunogen:

A synthesized peptide derived from human NUDT1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P36639 8ODP_HUMAN:

Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.

Description:
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
Sequence:
MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Sheep
100
Dog
100
Xenopus
100
Bovine
92
Zebrafish
92
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Antimutagenic. Plays a redundant role in sanitizing oxidized nucleotide pools, such as 8-oxo-dGTP pools. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA (By similarity).

PTMs:

The N-terminus is blocked.

Subcellular Location:

Cytoplasm>Cytosol. Mitochondrion matrix. Nucleus.
Note: Mostly present in cytosol (PubMed:7782328). A minor proportion is mitochondrial (PubMed:7782328). A very small amount of the protein is associated with nuclei (PubMed:7782328). Variant Met-124 has decreased efficiency in translocation to mitochondria (PubMed:16607562).

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.

Family&Domains:

Belongs to the Nudix hydrolase family.

References

1). MTH1 protects platelet mitochondria from oxidative damage and regulates platelet function and thrombosis. Nature Communications, 2023 (PubMed: 37563135) [IF=16.6]

Application: WB    Species: Mouse    Sample:

Fig. 4 Dysregulated protein phosphorylation in MTH1-deficient platelets after thrombin stimulation. a MTH1fl/fl or MTH1−/− platelets were treated with thrombin (1 U/ml) for 3 min followed by quantitative phosphoproteomics assay. b Differentially expressed phosphopeptides between two groups were presented as volcano map. X-axis shows the fold change (logarithmic conversion based on 2) and Y-axis shows the P-value (logarithmic conversion based on 10). Red dots represented the differentially upregulated phosphopeptides with significance and Blue dots showed the differentially downregulated phosphopeptides with significance. KEGG pathway analysis between control and MTH1-deficient platelets under the condition of resting (MA/NA) (c) or stimulation (MB/NB) (d). e MTH1fl/fl or MTH1−/− platelets were stimulated with thrombin (1 U/ml) followed by measuring the phosphorylation level of p38 MAPK, AKT, PLCβ3 and RhoA. The data were quantified based on three independent experiments (mean ± SD, n = 3 independent isolated platelets, two-way ANOVA with Sidak multiple comparisons test). f The number of differentially expressed phosphopeptides among the four groups. g Details of the 2 differentially expressed phosphopeptides localized in the mitochondria with significance identified from the comparison of control and MTH1-deficient platelets after thrombin stimulation (n = 3 independent experiments, two-tailed unpaired Student’s t test).

2). Tetrahydroxy stilbene glycoside ameliorates Alzheimer's disease in APP/PS1 mice via glutathione peroxidase related ferroptosis. International Immunopharmacology, 2021 (PubMed: 34333354) [IF=4.8]

Application: IF/ICC    Species: Mice    Sample: hippocampus tissues

Fig. 5. TSG promotes cell survival and decreases Aβ deposition. TSG treatment increases antioxidative ability in hippocampus. (A) The protein expression levels of Aβ, GSS, Peroxiredoxin 1, SOD1, SOD2 and iNOS were assessed by western blotting analysis. The levels were normalized to β-actin. (B) 8-OHdG, NeuN and DAPI fluorescence staining co-localization of WT, APP/PS1 and TSG 60 mg/kg group. P # < 0.05, P ## < 0.01 vs WT group. P* < 0.05, P ** < 0.01, P *** < 0.001 vs APP/PS1 group. 2×, 100 × magnification, scare bar: 500 and 100 μ m, n = 5/group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.