SEMG1 Antibody - #DF7369
| Product: | SEMG1 Antibody |
| Catalog: | DF7369 |
| Description: | Rabbit polyclonal antibody to SEMG1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 52kDa; 52kD(Calculated). |
| Uniprot: | P04279 |
| RRID: | AB_2839307 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7369, RRID:AB_2839307.
Fold/Unfold
Alpha-Inhibin-31; Alpha-Inhibin-92; Cancer/testis antigen 103; CT103; dJ172H20.2 (semenogelin I); dJ172H20.2; MGC14719; Semen coagulating protein; Semenogelin; Semenogelin I; SEMG; SEMG1; SEMG1_HUMAN; Seminal basic protein; seminal vesicle secretory protein 5; SgI; Svp-1; Svp5; SVPIIA; Svs2; SVS2P; Svs2p2; Svs5;
Immunogens
A synthesized peptide derived from human SEMG1, corresponding to a region within C-terminal amino acids.
- P04279 SEMG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT
Research Backgrounds
Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.
Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone.
Transglutaminase substrate.
Rapidly cleaved after ejaculation by KLK3/PSA, resulting in liquefaction of the semen coagulum and the progressive release of motile spermatozoa.
Secreted.
Seminal vesicle.
Belongs to the semenogelin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.