SNRPE Antibody - #DF7370
| Product: | SNRPE Antibody |
| Catalog: | DF7370 |
| Description: | Rabbit polyclonal antibody to SNRPE |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Chicken, Xenopus |
| Mol.Wt.: | 10kDa; 11kD(Calculated). |
| Uniprot: | P62304 |
| RRID: | AB_2839308 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7370, RRID:AB_2839308.
Fold/Unfold
AL022645; B raf; B-raf; Braf; C76690; HYPT11; RUXE_HUMAN; Sm protein E; Sm-E; Small nuclear ribonucleoprotein E; SmE; snRNP-E; snRNPE; snrpe;
Immunogens
A synthesized peptide derived from human SNRPE, corresponding to a region within the internal amino acids.
Widely expressed. In scalp skin, it is present in the hair follicle, the epidermis, and the dermis.
- P62304 RUXE_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
Cytoplasm>Cytosol. Nucleus.
Note: SMN-mediated assembly into core snRNPs occurs in the cytosol before SMN-mediated transport to the nucleus to be included in spliceosomes.
Widely expressed. In scalp skin, it is present in the hair follicle, the epidermis, and the dermis.
Belongs to the snRNP Sm proteins family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.