Product: Kallikrein 7 Antibody
Catalog: DF7384
Description: Rabbit polyclonal antibody to Kallikrein 7
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse
Mol.Wt.: 27kDa; 28kD(Calculated).
Uniprot: P49862
RRID: AB_2839322

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
Kallikrein 7 Antibody detects endogenous levels of total Kallikrein 7.
RRID:
AB_2839322
Cite Format: Affinity Biosciences Cat# DF7384, RRID:AB_2839322.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Chymotryptic stratum corneum; hK 7; hK7; hSCCE; Kallikrein 7 (chymotryptic stratum corneum); Kallikrein related peptidase 7; Kallikrein-7; Kallikrein7; KLK 7; Klk7; KLK7_HUMAN; Protease serine 6; PRSS 6; PRSS6; SCCE; Serine protease 6; Signal protein; Stratum corneum chymotryptic enzyme;

Immunogens

Immunogen:

A synthesized peptide derived from human Kallikrein 7, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P49862 KLK7_HUMAN:

Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).

Description:
This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, which is one of fifteen kallikrein subfamily members located in a gene cluster on chromosome 19.
Sequence:
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Research Backgrounds

Function:

May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.

Subcellular Location:

Secreted.
Note: In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).

Family&Domains:

Belongs to the peptidase S1 family. Kallikrein subfamily.

References

1). Therapeutic effects of quinine in a mouse model of atopic dermatitis. Molecular Medicine Reports, 2021 (PubMed: 34240224) [IF=3.4]

Application: WB    Species: Mice    Sample: skin tissue

Figure 4. Effects of quinine on protein and mRNA expression in AD-like mice. (A) Protein expression of FLG and KLK7 evaluated via western blotting. (B) Relative ratio of FLG/GAPDH. (C) Relative ratio of KLK7/GAPDH. (D) Protein expression of FLG evaluated via immunohistochemistry. (E) Protein expression of KLK7 evaluated via immunohistochemistry. mRNA expression of (F) IκBα, (G) IKKα and (H) NF-κB determined via reverse transcription-quantitative PCR analysis. Data are presented as the mean ± standard deviation. *P<0.05, **P<0.001 vs. control; #P<0.05, ##P<0.001 vs. AD. AD, atopic dermatitis; AD + Q, AD group treated with quinine; C + Q, control group treated with quinine; FLG, filaggrin; KLK7, kallikrein-7; IKKα, IκB kinase α.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.