PSMF1 Antibody - #DF7394
Product: | PSMF1 Antibody |
Catalog: | DF7394 |
Description: | Rabbit polyclonal antibody to PSMF1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 29kDa; 30kD(Calculated). |
Uniprot: | Q92530 |
RRID: | AB_2839332 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7394, RRID:AB_2839332.
Fold/Unfold
hPI31; PI31; Proteasome (prosome macropain) inhibitor subunit 1; Proteasome inhibitor hP131 subunit; Proteasome inhibitor PI31 subunit; PSMB2; Psmf1; PSMF1_HUMAN; RP23 402M7.5; RP4 545L17.1;
Immunogens
A synthesized peptide derived from human PSMF1, corresponding to a region within C-terminal amino acids.
- Q92530 PSMF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.
Cytoplasm. Endoplasmic reticulum.
Belongs to the proteasome inhibitor PI31 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Proteasome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.