| Product: | PAX4 Antibody |
| Catalog: | BF0438 |
| Description: | Mouse monoclonal antibody to PAX4 |
| Application: | WB ELISA |
| Reactivity: | Human |
| Mol.Wt.: | 38kDa(Observed); 38kD(Calculated). |
| Uniprot: | O43316 |
| RRID: | AB_2833880 |
Control Products
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# BF0438, RRID:AB_2833880.
Fold/Unfold
KPD; MGC129960; MODY9; Paired box 4; Paired box gene 4; paired box homeotic gene 4; Paired box protein Pax-4; Paired domain gene 4; Pax4; PAX4_HUMAN;
Immunogens
Purified recombinant fragment of human PAX4 expressed in E. Coli.
- O43316 PAX4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHQDGISSMNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACLKPCWDCGSFLLPVIAPSCVDVAWPCLDASLAHHLIGGAGKATPTHFSHWP
Research Backgrounds
Plays an important role in the differentiation and development of pancreatic islet beta cells. Transcriptional repressor that binds to a common element in the glucagon, insulin and somatostatin promoters. Competes with PAX6 for this same promoter binding site. Isoform 2 appears to be a dominant negative form antagonizing PAX4 transcriptional activity.
Nucleus.
Belongs to the paired homeobox family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Maturity onset diabetes of the young.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.