Product: CEA Antibody
Catalog: BF0092
Description: Mouse monoclonal antibody to CEA
Application: WB IHC IF/ICC ELISA
Cited expt.: IF/ICC
Reactivity: Human
Mol.Wt.: 77kDa(Observed); 77kD(Calculated).
Uniprot: P06731
RRID: AB_2833881

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:200-1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFB1857]
Specificity:
CEA antibody detects endogenous levels of total CEA.
RRID:
AB_2833881
Cite Format: Affinity Biosciences Cat# BF0092, RRID:AB_2833881.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Carcinoembryonic antigen; Carcinoembryonic antigen-related cell adhesion molecule 5; CD66e; CEA; Ceacam5; CEAM5_HUMAN; DKFZp781M2392; Meconium antigen 100; OTTHUMP00000199032; OTTHUMP00000199033; OTTHUMP00000199034;

Immunogens

Immunogen:

Purified recombinant fragment of human CEA expressed in E. Coli.

Uniprot:
Gene(ID):
Expression:
P06731 CEAM5_HUMAN:

Expressed in columnar epithelial and goblet cells of the colon (at protein level) (PubMed:10436421). Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.

Description:
Carcino Embryonic Antigen (CEA) is synthesised during development in the fetal gut, and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. Antibodies to CEA are useful in identifying the origin of various metastatic adenocarcinomas and in distinguishing pulmonary adenocarcinomas (60 to 70% are CEA+) from pleural mesotheliomas (rarely or weakly CEA+).
Sequence:
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI

Research Backgrounds

Function:

Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.

(Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.

PTMs:

Complex immunoreactive glycoprotein with a MW of 180 kDa comprising 60% carbohydrate.

Subcellular Location:

Cell membrane>Lipid-anchor. Apical cell membrane. Cell surface.
Note: Localized to the apical glycocalyx surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in columnar epithelial and goblet cells of the colon (at protein level). Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.

Family&Domains:

Belongs to the immunoglobulin superfamily. CEA family.

References

1). Upregulation of ITGB6 in primary palmar hyperhidrosis. Advances in clinical and experimental medicine : official organ Wroclaw Medical University, 2023 (PubMed: 37212774) [IF=2.1]

Application: IF/ICC    Species: Human    Sample:

Fig. 2. Identification of human sweat gland cells and verification of integrin β6 (ITGB6) overexpression transfection efficiency. A. Immunofluorescence staining of CEA (green) and CK7 (red) in sweat gland cells extracted from patients with primary palmar hyperhidrosis. The cell nuclei were stained with 4’,6-diamidino-2-phenylindole (DAPI) (blue); B. Quantitative polymerase chain reaction (ITGB6 compared to control, Tukey’s honest significant difference (HSD), p < 0.001; ITGB6 compared to negative control (NC), Tukey’s HSD, p < 0.001); C,D. Western blot detection of the transfection efficiency of ITGB6 overexpression analysis results (ITGB6 compared to control, Tukey’s HSD, p < 0.001; ITGB6 compared to NC, Tukey’s HSD, p < 0.001). The data are presented as mean ± 95% confidence interval (95% CI)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.