Product: Tubulin beta Antibody
Catalog: T0034
Description: Mouse monoclonal antibody to Tubulin beta
Application: WB ELISA
Cited expt.: WB
Reactivity: Zebrafish
Mol.Wt.: 55 KD; 50kD(Calculated).
Uniprot: P07437
RRID: AB_2839425

View similar products>>

   Size Price Inventory
 50ul $150 In stock
 100ul $250 In stock
 200ul $350 In stock
 1ml $1200 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:3000-1:10000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Zebrafish
Clonality:
Monoclonal [F301]
Specificity:
Theβ-tubulin antibody can detects Zebrafish endogenousβ-tubulin protein.
RRID:
AB_2839425
Cite Format: Affinity Biosciences Cat# T0034, RRID:AB_2839425.
Conjugate:
Unconjugated.
Purification:
affinity purification.
Storage:
PBS, pH 7.4, containing 0.02% sodium azide as Preservative and 50% Glycerol.Store at -20°C. Do not aliquot the antibody. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

TUBB, Beta Tubulin, Beta 5-tubulin, Beta-4 tubulin, Beta1-tubulin, M40, Tubulin beta-5 chain, Beta Ib tubulin, Class I beta-tubulin, OK/SW-cl.56, TUBB5, Tubulin beta chain, Tubulin beta polypeptide, Tubulin beta-1 chain, Tubulin, beta class I, Tubuli ...

Immunogens

Immunogen:

Peptide.

Uniprot:
Gene(ID):
Expression:
P07437 TBB5_HUMAN:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Description:
Microtubules are constituent parts of the mitotic apparatus, cilia, flagella, and elements of the cytoskeleton. They consist principally of 2 soluble proteins, alpha- and beta-tubulin, each of about 55,000 Da. Antibodies against beta Tubulin are useful as loading controls for Western Blotting. However it should be noted that levels of β-Tubulin may not be stable in certain cells. For example, expression of β-Tubulin in adipose tissue is very low and therefore β-Tubulin should not be used as loading control for these tissues.
Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

Research Backgrounds

Function:

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

PTMs:

Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group. Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold.

Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear (Probable).

Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Family&Domains:

The highly acidic C-terminal region may bind cations such as calcium.

Belongs to the tubulin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

References

1). An EGFP Knock-in Zebrafish Experimental Model Used in Evaluation of the Amantadine Drug Safety During Early Cardiogenesis. Frontiers in Cardiovascular Medicine, 2022 (PubMed: 35449877) [IF=2.8]

Application: WB    Species: Fish    Sample: vmhcKI–EGFP KI fish line

FIGURE 2 Enhanced green fluorescent protein in the vmhcKI–EGFP zebrafish KI line recapitulates endogenous expression patterns of the vmhc gene. (A) EGFP patterns in the vmhcKI–EGFP KI fish line from 16 to 18 somite stage (SS) to 48 hpf. Scale bar, 100 μm. White arrows point to specific patterns of the EGFP signal. (B) Endogenous expression patterns of the vmhc gene from 16 to 18 somite stage (SS) to 48 hpf revealed by WISH. Black arrows point to the specific expression pattern of vmhc endogenous transcripts. The dotted line outlines the shape of the atrium. Scale bar, 100 μm. (C) Western blotting and quantification analysis of the Vmhc protein expression in the vmhcKI–EGFP KI fish line compared to wild-type (WT) control. N = 4. Unpaired 2-tailed Student’s t-test. V, ventricle. A, atrium.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.