DIRAS3 Antibody - #DF2200
| Product: | DIRAS3 Antibody |
| Catalog: | DF2200 |
| Description: | Rabbit polyclonal antibody to DIRAS3 |
| Application: | WB IHC |
| Reactivity: | Human |
| Mol.Wt.: | 26 kDa.; 26kD(Calculated). |
| Uniprot: | O95661 |
| RRID: | AB_2839431 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2200, RRID:AB_2839431.
Fold/Unfold
DIRA3; DIRA3_HUMAN; DIRAS family GTP binding RAS like 3; DIRAS family GTPase 3; DIRAS family, GTP-binding RAS-like protein 3; DIRAS3; Distinct subgroup of the Ras family member 3; GTP binding protein Di Ras3; GTP-binding protein Di-Ras3; NOEY2; Ras homolog gene family member I; Rho related GTP binding protein RhoI; Rho-related GTP-binding protein RhoI; RHOI;
Immunogens
A synthesized peptide derived from human DIRAS3, corresponding to a region within C-terminal amino acids.
Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
- O95661 DIRA3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Research Backgrounds
Cell membrane>Lipid-anchor>Cytoplasmic side.
Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Belongs to the small GTPase superfamily. Di-Ras family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.