SYF2 Antibody - #DF2224
| Product: | SYF2 Antibody |
| Catalog: | DF2224 |
| Description: | Rabbit polyclonal antibody to SYF2 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 28kDa; 29kD(Calculated). |
| Uniprot: | O95926 |
| RRID: | AB_2839455 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2224, RRID:AB_2839455.
Fold/Unfold
CBPIN; CCNDBP1 interactor; CCNDBP1-interactor; DKFZp564O2082; fSAP29; Functional spliceosome associated protein 29; GCIP interacting protein p29; GCIPIP; NTC31; P29; Pre mRNA splicing factor SYF2; Pre-mRNA-splicing factor syf2; syf2; SYF2 homolog; SYF2 homolog RNA splicing factor (S. cerevisiae); SYF2 homolog RNA splicing factor; SYF2_HUMAN;
Immunogens
A synthesized peptide derived from human SYF2, corresponding to a region within C-terminal amino acids.
Abundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues.
- O95926 SYF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in pre-mRNA splicing as component of the spliceosome.
Nucleus.
Abundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues.
Belongs to the SYF2 family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.