RFPL1 Antibody - #DF2231
Product: | RFPL1 Antibody |
Catalog: | DF2231 |
Description: | Rabbit polyclonal antibody to RFPL1 |
Application: | WB IHC |
Reactivity: | Human |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | O75677 |
RRID: | AB_2839462 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2231, RRID:AB_2839462.
Fold/Unfold
MGC132428; Ret finger protein-like 1; RFPL1; RFPL1_HUMAN; RING finger protein 78; RNF78;
Immunogens
A synthesized peptide derived from human RFPL1, corresponding to a region within the internal amino acids.
Seems to be expressed in prostate and less abundantly in adult brain, fetal liver, and fetal kidney.
- O75677 RFPL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK
Research Backgrounds
Negatively regulates the G2-M phase transition, possibly by promoting cyclin B1/CCNB1 and CDK1 proteasomal degradation and thereby preventing their accumulation during interphase.
Phosphorylated by PKC and CDK1. The antiproliferative effect seems to be positively regulated by PKC phosphorylation and negatively by CDK1 phosphorylation.
Cytoplasm. Nucleus.
Note: A higher concentration is observed in the cytoplasm compared to the nucleus.
Seems to be expressed in prostate and less abundantly in adult brain, fetal liver, and fetal kidney.
The B30.2/SPRY domain is required for the negative regulation of cell proliferation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.