CCL24 Antibody - #DF2240
| Product: | CCL24 Antibody |
| Catalog: | DF2240 |
| Description: | Rabbit polyclonal antibody to CCL24 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 13 kDa; 13kD(Calculated). |
| Uniprot: | O00175 |
| RRID: | AB_2839471 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2240, RRID:AB_2839471.
Fold/Unfold
C-C motif chemokine 24; CCL24; CCL24_HUMAN; Chemokine CC Motif Ligand 24; CK beta 6; CK-beta-6; Ckb6; Eosinophil chemotactic protein 2; Eotaxin-2; MPIF-2; MPIF2; Myeloid progenitor inhibitory factor 2; SCYA24; Small inducible cytokine subfamily A (Cys-Cys) member 24; Small-inducible cytokine A24;
Immunogens
A synthesized peptide derived from human CCL24, corresponding to a region within C-terminal amino acids.
- O00175 CCL24_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Research Backgrounds
Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.
N-glycosylated.
Secreted.
Activated monocytes and activated T lymphocytes.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.