UBE2R2 Antibody - #DF2262
| Product: | UBE2R2 Antibody |
| Catalog: | DF2262 |
| Description: | Rabbit polyclonal antibody to UBE2R2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Monkey |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 27 kDa,17kDa; 27kD(Calculated). |
| Uniprot: | Q712K3 |
| RRID: | AB_2839491 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2262, RRID:AB_2839491.
Fold/Unfold
CDC34B; E2 CDC34B; E2 ubiquitin conjugating enzyme R2; FLJ20419; MGC10481; UB2R2; UB2R2_HUMAN; UBC3B; UBE2R2; Ubiquitin carrier protein R2; Ubiquitin conjugating enzyme E2 CDC34B; Ubiquitin conjugating enzyme E2 R2; Ubiquitin conjugating enzyme E2R 2; Ubiquitin conjugating enzyme UBC3B; Ubiquitin protein ligase R2; Ubiquitin-conjugating enzyme E2 R2; Ubiquitin-conjugating enzyme E2-CDC34B; Ubiquitin-protein ligase R2;
Immunogens
A synthesized peptide derived from human UBE2R2, corresponding to a region within C-terminal amino acids.
- Q712K3 UB2R2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes monoubiquitination and 'Lys-48'-linked polyubiquitination. May be involved in degradation of katenin.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.