BCL2L10 Antibody - #DF2276
Product: | BCL2L10 Antibody |
Catalog: | DF2276 |
Description: | Rabbit polyclonal antibody to BCL2L10 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Rabbit |
Mol.Wt.: | 22 kDa; 23kD(Calculated). |
Uniprot: | Q9HD36 |
RRID: | AB_2839505 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2276, RRID:AB_2839505.
Fold/Unfold
Anti apoptotic protein NrH; Anti-apoptotic protein NrH; Apoptosis regulator Bcl B; Apoptosis regulator Bcl-B; B2L10_HUMAN; BCL B; Bcl-2-like protein 10; Bcl2 L 10; BCL2 like 10 (apoptosis facilitator); BCL2 like 10 protein; Bcl2-L-10; Bcl2l10; BCLB; Boo; Diva; MGC129810; MGC129811; Nrh;
Immunogens
A synthesized peptide derived from human BCL2L10, corresponding to a region within the internal amino acids.
Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney.
- Q9HD36 B2L10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Promotes cell survival. Suppresses apoptosis induced by BAX but not BAK.
Mitochondrion. Nucleus membrane.
Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney.
Belongs to the Bcl-2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.