PHLDA3 Antibody - #DF2389
| Product: | PHLDA3 Antibody |
| Catalog: | DF2389 |
| Description: | Rabbit polyclonal antibody to PHLDA3 |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Rabbit |
| Mol.Wt.: | 14 kDa; 14kD(Calculated). |
| Uniprot: | Q9Y5J5 |
| RRID: | AB_2839597 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2389, RRID:AB_2839597.
Fold/Unfold
PHLA3_HUMAN; PHLDA 3; phlda3; Pleckstrin homology like domain family A member 2; Pleckstrin homology like domain family A member 3; Pleckstrin homology-like domain family A member 3; TDAG51/Ipl homolog 1; TDAG51/Ipl homologue 1; TIH 1; TIH1;
Immunogens
A synthesized peptide derived from human PHLDA3, corresponding to a region within C-terminal amino acids.
- Q9Y5J5 PHLA3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.
Cytoplasm. Membrane>Peripheral membrane protein.
Widely expressed with lowest expression in liver and spleen.
The PH domain binds phosphoinositides with a broad specificity. It competes with the PH domain of AKT1 and directly interferes with AKT1 binding to phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3), preventing AKT1 association to membrane lipids and subsequent activation of AKT1 signaling.
Belongs to the PHLDA3 family.
References
Application: WB Species: Human Sample: prostate cancer cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.