Cyclin A Antibody - #AF0142

(10)   (27)  
Product: Cyclin A Antibody
Catalog: AF0142
Description: Rabbit polyclonal antibody to Cyclin A
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 53kDa; 52kD,49kD(Calculated).
Uniprot: P78396 | P20248
RRID: AB_2833324

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Cyclin A Antibody detects endogenous levels of total Cyclin A.
RRID:
AB_2833324
Cite Format: Affinity Biosciences Cat# AF0142, RRID:AB_2833324.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CCN A1; CCNA 1; Ccna1; CCNA1_HUMAN; Cyclin-A1; CyclinA1; G2/mitotic specific cyclin A1; MGC132235; MGC159139; CCN1; CCNA; Ccna2; CCNA2_HUMAN; Cyclin A2; Cyclin-A; Cyclin-A2;

Immunogens

Immunogen:
Uniprot:

P78396(CCNA1_HUMAN) >>Visit HPA database.

P20248(CCNA2_HUMAN) >>Visit HPA database.

Gene(ID):
CCNA2(890) | CCNA1(8900)
Expression:
P78396 CCNA1_HUMAN:

Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.

Description:
CCNA1 May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells. Belongs to the cyclin family；CCNA2 a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle.
Sequence:
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Xenopus
75
Zebrafish
75
Chicken
75
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P78396/P20248 As Substrate

Site PTM Type Enzyme
Ubiquitination
T168 Phosphorylation
S280 Phosphorylation
Site PTM Type Enzyme
Ubiquitination
M1 Acetylation
S5 Phosphorylation
K37 Ubiquitination
K54 Acetylation
K54 Ubiquitination
S55 Phosphorylation
K68 Acetylation
K76 Acetylation
K95 Acetylation
K95 Ubiquitination
K112 Acetylation
Y146 Phosphorylation
S151 Phosphorylation
S154 Phosphorylation P24941 (CDK2)
K192 Ubiquitination
S209 Phosphorylation
Y225 Phosphorylation
S244 Phosphorylation
T380 Phosphorylation
K388 Ubiquitination
K400 Ubiquitination
K417 Ubiquitination

Research Backgrounds

Function:

May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.

PTMs:

Polyubiquitinated via 'Lys-11'-linked ubiquitin by the anaphase-promoting complex (APC/C), leading to its degradation by the proteasome. Deubiquitinated and stabilized by USP37 enables entry into S phase.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.

Subunit Structure:

Interacts with the CDK2 and the CDC2 protein kinases to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex. Does not bind CDK4 and CDK5 (in vitro). The cyclin A1-CDK2 complex interacts with transcription factor E2F-1 and RB proteins. Found in a complex with CDK2, CABLES1 and CCNE1 (By similarity). Interacts with INCA1. Interacts with KLHDC9.

Family&Domains:

Belongs to the cyclin family. Cyclin AB subfamily.

Function:

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

PTMs:

Polyubiquitinated via 'Lys-11'-linked ubiquitin by the anaphase-promoting complex (APC/C), leading to its degradation by the proteasome. Deubiquitinated and stabilized by USP37 enables entry into S phase.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Exclusively nuclear during interphase (PubMed:1312467). Detected in the nucleus and the cytoplasm at prophase (PubMed:1312467). Cytoplasmic when associated with SCAPER (PubMed:17698606).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with the CDK1 and CDK2 protein kinases to form serine/threonine kinase holoenzyme complexes. Interacts with CDK1 (hyperphosphorylated form in G1 and underphosphorylated forms in S and G2). Interacts with CDK2; the interaction increases from G1 to G2. Interacts (associated with CDK2 but not with CDK1) with SCAPER; regulates the activity of CCNA2/CDK2 by transiently maintaining CCNA2 in the cytoplasm. Forms a ternary complex with CDK2 and CDKN1B; CDKN1B inhibits the kinase activity of CDK2 through conformational rearrangements. Interacts with INCA1.

(Microbial infection) Interacts with human cytomegalovirus protein UL32.

Family&Domains:

Belongs to the cyclin family. Cyclin AB subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > AMPK signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Acute myeloid leukemia.   (View pathway)

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

References

1). Zhao J et al. Combination LSD1 and HOTAIR-EZH2 inhibition disrupts cell cycle processes and induces apoptosis in glioblastoma cells. PHARMACOLOGICAL RESEARCH 2021 Sep;171:105764. (PubMed: 34246782) [IF=9.3]
2). Yu C et al. Trans-anethole ameliorates LPS-induced inflammation via suppression of TLR4/NF-κB pathway in IEC-6 cells. International Immunopharmacology 2022 May 23;108:108872. (PubMed: 35617845) [IF=5.6]
3). Liao S et al. The receptor for activated protein kinase C promotes cell growth, invasion and migration in cervical cancer. INTERNATIONAL JOURNAL OF ONCOLOGY 2017 Nov;51(5):1497-1507 (PubMed: 29048616) [IF=5.2]

Application: WB    Species: human    Sample:

4). Lv C et al. High Iodine Induces the Proliferation of Papillary and Anaplastic Thyroid Cancer Cells via AKT/Wee1/CDK1 Axis. Frontiers in Oncology 2021 Mar 16;11:622085. (PubMed: 33796458) [IF=4.7]
5). Liao S et al. CD38 enhances the proliferation and inhibits the apoptosis of cervical cancer cells by affecting the mitochondria functions. MOLECULAR CARCINOGENESIS 2017 Oct;56(10):2245-2257 (PubMed: 28544069) [IF=4.6]

Application: WB    Species: human    Sample:

Western blot analysis indicated that CD38 correlated with P53/P21/cyclinD1 pathway
6). Huang YX et al. Ovostatin 2 knockdown significantly inhibits the growth, migration, and tumorigenicity of cutaneous malignant melanoma cells. PLoS One 2018 Apr 23;13(4):e0195610 (PubMed: 29684087) [IF=3.7]

Application: WB    Species: mouse    Sample: A375 cells

Fig 5. |Western blot results. (a) The levels of cyclin A, cyclin B, cyclin D1, and CDK2 were reduced in A375 cells transfected with OVOS2-shRNA
7). Wang X et al. Regulation of the PTEN/PI3K/AKT pathway in RCC using the active compounds of natural products in vitro. Molecular Medicine Reports 2021 Nov;24(5):766. (PubMed: 34490473) [IF=3.4]

Application: WB    Species: human    Sample: 786‑O and OS‑RC‑2 cells

Figure 3.| Naringenin arrests cell cycle progression of renal cell carcinoma cells in the G2 phase. 786‑O and OS‑RC‑2 cells were treated with naringenin (0, 4 or 8 µM) for 48 h. (A) Cell cycle distribution was determined using flow cytometry. (B) Western blot analysis of cyclin E1, cyclin A2, cyclin B1, cyclin D1, P27 and P21 expression levels. Data are presented as the mean ± SD. * P<0.05, **P<0.01 vs. Abs. Abs, absolute ethanol.

Application: WB    Species: Human    Sample: 786-O and OS-RC-2 cells

Figure 3. Naringenin arrests cell cycle progression of renal cell carcinoma cells in the G2 phase. 786-O and OS-RC-2 cells were treated with naringenin (0, 4 or 8 µM) for 48 h. (A) Cell cycle distribution was determined using flow cytometry. (B) Western blot analysis of cyclin E1, cyclin A2, cyclin B1, cyclin D1, P27 and P21 expression levels. Data are presented as the mean ± SD. *P<0.05, **P<0.01 vs. Abs. Abs, absolute ethanol.
8). Zhuang W et al. miR-92a-2-5p Regulates the Proliferation and Differentiation of ASD-Derived Neural Progenitor Cells. CURRENT ISSUES IN MOLECULAR BIOLOGY 2022 May 24;44(6):2431-2442. (PubMed: 35735607) [IF=3.1]

Application: WB    Species: Human    Sample: Neural Progenitor Cells

Figure 2 Abnormal cell cycle of ASD-NPCs, with no difference in apoptosis. (A,B) CON and ASD-NPCs were stained with Hoechst (blue) and PI (red). The percentage of PI-labeled cells was calculated. (C,D) FCM analyses of the cell cycle of NPCs showing the percentages of cells at different cell cycle phases. (E–G) Relative expression of cell cycle-related genes of CON and ASD-NPCs as determined by RT-qPCR and western blot. All data represent mean ± SEM; scale bar: 100 μm; *** p < 0.001, ** p < 0.01, * p < 0.05.
9). Chen H et al. Vascular endothelial growth factor C enhances cervical cancer migration and invasion via activation of focal adhesion kinase. GYNECOLOGICAL ENDOCRINOLOGY 2013 Jan;29(1):20-4 (PubMed: 22817694) [IF=2.0]
10). Jiayu Cao et al. The expressions of DNA methyltransferase 1 (DNMT1) and cyclin A1 (CCNA1) in cervical carcinogenesis. International Journal of Clinical and Experimental Pathology (PubMed: 31933719) [IF=1.4]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.