ARL11 Antibody - #DF2443
| Product: | ARL11 Antibody |
| Catalog: | DF2443 |
| Description: | Rabbit polyclonal antibody to ARL11 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 21 kDa; 21kD(Calculated). |
| Uniprot: | Q969Q4 |
| RRID: | AB_2839649 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2443, RRID:AB_2839649.
Fold/Unfold
ADP ribosylation factor like 11; ADP ribosylation factor like protein 11; ADP ribosylation factor like tumor suppressor protein 1; ADP-ribosylation factor-like protein 11; ADP-ribosylation factor-like tumor suppressor protein 1; ARL11; ARL11_HUMAN; ARLTS1;
Immunogens
A synthesized peptide derived from human ARL11, corresponding to a region within the internal amino acids.
- Q969Q4 ARL11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Research Backgrounds
May play a role in apoptosis. May act as a tumor suppressor.
Expressed in lung and leukocytes.
Belongs to the small GTPase superfamily. Arf family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.