HEXIM2 Antibody - #DF2448
Product: | HEXIM2 Antibody |
Catalog: | DF2448 |
Description: | Rabbit polyclonal antibody to HEXIM2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 32 kDa; 32kD(Calculated). |
Uniprot: | Q96MH2 |
RRID: | AB_2839654 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2448, RRID:AB_2839654.
Fold/Unfold
Hexamethylene bis-acetamide-inducible protein 2; Hexamthylene bis-acetamide inducible 2; HEXI2_HUMAN; hexim 2; HEXIM2; L3; Protein HEXIM2;
Immunogens
A synthesized peptide derived from human HEXIM2, corresponding to a region within the internal amino acids.
Ubiquitously expressed with higher expression in testis. HEXIM1 and HEXIM2 are differentially expressed.
- Q96MH2 HEXI2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor. In cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
Nucleus.
Ubiquitously expressed with higher expression in testis. HEXIM1 and HEXIM2 are differentially expressed.
The coiled-coil domain mediates oligomerization.
Belongs to the HEXIM family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.