ROAA Antibody - #DF2453
| Product: | ROAA Antibody |
| Catalog: | DF2453 |
| Description: | Rabbit polyclonal antibody to ROAA |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Chicken, Xenopus |
| Mol.Wt.: | 36kDa; 36kD(Calculated). |
| Uniprot: | Q99729 |
| RRID: | AB_2839659 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2453, RRID:AB_2839659.
Fold/Unfold
ABBP 1; ABBP-1; ABBP1; Apobec 1 binding protein 1; APOBEC1 binding protein 1; APOBEC1-binding protein 1; Apolipoprotein B mRNA editing enzyme catalytic polypeptide 1- protein 1; FLJ40338; Heterogeneous nuclear ribonucleoprotein A/B; hnRNP A/B; hnRNP type A/B protein; HNRNPAB; HNRPAB; ROAA_HUMAN;
Immunogens
- Q99729 ROAA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99729 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S81 | Phosphorylation | Uniprot | |
| K82 | Acetylation | Uniprot | |
| K82 | Ubiquitination | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| K86 | Acetylation | Uniprot | |
| K86 | Ubiquitination | Uniprot | |
| K91 | Acetylation | Uniprot | |
| K91 | Ubiquitination | Uniprot | |
| C98 | S-Nitrosylation | Uniprot | |
| T99 | Phosphorylation | Uniprot | |
| K101 | Ubiquitination | Uniprot | |
| K118 | Ubiquitination | Uniprot | |
| K125 | Ubiquitination | Uniprot | |
| K130 | Ubiquitination | Uniprot | |
| K190 | Ubiquitination | Uniprot | |
| K215 | Acetylation | Uniprot | |
| K215 | Ubiquitination | Uniprot | |
| K223 | Ubiquitination | Uniprot | |
| K227 | Ubiquitination | Uniprot | |
| K232 | Ubiquitination | Uniprot | |
| Y235 | Phosphorylation | Uniprot | |
| Y240 | Phosphorylation | Uniprot | |
| S242 | Phosphorylation | Uniprot | |
| R245 | Methylation | Uniprot | |
| R248 | Methylation | Uniprot | |
| R250 | Methylation | Uniprot | |
| R253 | Methylation | Uniprot | |
| Y300 | Phosphorylation | Uniprot | |
| R321 | Methylation | Uniprot | |
| R322 | Methylation | Uniprot | |
| Y329 | Phosphorylation | Uniprot | |
| K330 | Acetylation | Uniprot | |
| K330 | Methylation | Uniprot | |
| Y332 | Phosphorylation | Uniprot |
Research Backgrounds
Binds single-stranded RNA. Has a high affinity for G-rich and U-rich regions of hnRNA. Also binds to APOB mRNA transcripts around the RNA editing site.
Dimethylation at Arg-322 is probably asymmetric.
Nucleus. Cytoplasm.
Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Ubiquitous.
Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs. Interacts with APOBEC1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.