HOP Antibody - #DF2456
| Product: | HOP Antibody |
| Catalog: | DF2456 |
| Description: | Rabbit polyclonal antibody to HOP |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Chicken |
| Mol.Wt.: | 8 kDa; 8kD(Calculated). |
| Uniprot: | Q9BPY8 |
| RRID: | AB_2839662 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2456, RRID:AB_2839662.
Fold/Unfold
CAMEO; heart odd homeobox 1 protein; HOD; Homeodomain-only protein; HOP; HOP homeobox; HOP_HUMAN; HOPX; LAGY; Lung cancer-associated Y protein; NECC1; Not expressed in choriocarcinoma clone 1; Not expressed in choriocarcinoma protein 1; OB1; odd homeobox 1 protein; Odd homeobox protein 1; OTTHUMP00000158970; SMAP31; TOTO;
Immunogens
A synthesized peptide derived from human HOP, corresponding to a region within C-terminal amino acids.
Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.
- Q9BPY8 HOP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and assists in chaperone-mediated protein refolding.
Nucleus. Cytoplasm.
Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.