TRI31 Antibody - #DF2463

Product: | TRI31 Antibody |
Catalog: | DF2463 |
Description: | Rabbit polyclonal antibody to TRI31 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 48kDa; 48kD(Calculated). |
Uniprot: | Q9BZY9 |
RRID: | AB_2839669 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2463, RRID:AB_2839669.
Fold/Unfold
C6orf13; H.sapiens mRNA for RING protein; HCG1; HCGI; Ring finger protein; RNF; Tripartite motif containing protein 31;
Immunogens
A synthesized peptide derived from human TRI31, corresponding to a region within the internal amino acids.
- Q9BZY9 TRI31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Research Backgrounds
Regulator of Src-induced anchorage independent cell growth (By similarity). May have E3 ubiquitin-protein ligase activity.
Auto-ubiquitinated (in vitro).
Cytoplasm. Mitochondrion.
Note: Predominantly expressed in the cytoplasm but a fraction is associated with the mitochondria.
Up-regulated in gastric adenocarcinomas.
Belongs to the TRIM/RBCC family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.