SLC35C2 Antibody - #DF2473
| Product: | SLC35C2 Antibody |
| Catalog: | DF2473 |
| Description: | Rabbit polyclonal antibody to SLC35C2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 40 kDa; 40kD(Calculated). |
| Uniprot: | Q9NQQ7 |
| RRID: | AB_2839679 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2473, RRID:AB_2839679.
Fold/Unfold
BA394O2.1; C20orf5; CGI-15; FLJ37039; MGC20633; MGC32079; MGC39183; Ovarian cancer-overexpressed gene 1 protein; OVCOV1; S35C2_HUMAN; SLC35C2; Solute carrier family 35 (GDP fucose transporter), member C2; Solute carrier family 35 member C2;
Immunogens
Ubiquitously expressed although the level of expression is tissue dependent. Overexpressed in ovarian cancer.
- Q9NQQ7 S35C2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRWALDVAFLWKAVLTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCSSHRARVVLSWADYLRRVAPTALATALDVGLSNWSFLYVTVSLYTMTKSSAVLFILIFSLIFKLEELRAALVLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRWTLTQMLLQKAELGLQNPIDTMFHLQPLMFLGLFPLFAVFEGLHLSTSEKIFRFQDTGLLLRVLGSLFLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAAHLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ
PTMs - Q9NQQ7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S101 | Phosphorylation | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| Y107 | Phosphorylation | Uniprot | |
| S118 | Phosphorylation | Uniprot | |
| S119 | Phosphorylation | Uniprot | |
| K331 | Ubiquitination | Uniprot | |
| S335 | Phosphorylation | Uniprot | |
| S336 | Phosphorylation | Uniprot | |
| Y358 | Phosphorylation | Uniprot |
Research Backgrounds
May play an important role in the cellular response to tissue hypoxia. May be either a GDP-fucose transporter that competes with SLC35C1 for GDP-fucose, or a factor that otherwise enhances the fucosylation of Notch and is required for optimal Notch signaling in mammalian cells.
Membrane>Multi-pass membrane protein. Golgi apparatus>cis-Golgi network membrane. Endoplasmic reticulum-Golgi intermediate compartment membrane.
Ubiquitously expressed although the level of expression is tissue dependent. Overexpressed in ovarian cancer.
Belongs to the TPT transporter family. SLC35C subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.