HSPB8 Antibody - #DF2481
| Product: | HSPB8 Antibody |
| Catalog: | DF2481 |
| Description: | Rabbit polyclonal antibody to HSPB8 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q9UJY1 |
| RRID: | AB_2839687 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2481, RRID:AB_2839687.
Fold/Unfold
Alpha crystallin C chain; Alpha-crystallin C chain; Charcot Marie Tooth disease axonal type 2L; Charcot Marie Tooth disease spinal; CMT2L; CRYAC; DHMN 2; DHMN2; E2 induced gene 1 protein; E2-induced gene 1 protein; E2IG1; H11; Heat shock 22kDa protein 8; Heat shock 27kDa protein 8; Heat shock protein 22; Heat shock protein beta 8; Heat shock protein beta-8; Hereditary motor neuropathy distal; HMN 2; HMN2; HMN2A; HSB8; HSPB 8; HspB8; HSPB8_HUMAN; OTTHUMP00000239768; Protein kinase H11; Small stress protein like protein HSP22; Small stress protein-like protein HSP22; Spinal muscular atrophy distal adult autosomal dominant;
Immunogens
A synthesized peptide derived from human HSPB8, corresponding to a region within C-terminal amino acids.
- Q9UJY1 HSPB8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Displays temperature-dependent chaperone activity.
Cytoplasm. Nucleus.
Note: Translocates to nuclear foci during heat shock.
Predominantly expressed in skeletal muscle and heart.
Belongs to the small heat shock protein (HSP20) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.