IGFBPL1 Antibody - #DF2512
| Product: | IGFBPL1 Antibody |
| Catalog: | DF2512 |
| Description: | Rabbit polyclonal antibody to IGFBPL1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Sheep, Rabbit |
| Mol.Wt.: | 29 kDa; 29kD(Calculated). |
| Uniprot: | Q8WX77 |
| RRID: | AB_2839718 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2512, RRID:AB_2839718.
Fold/Unfold
bA113O24.1; IGFBP-related protein 10; IGFBP-RP4; IGFBPL1; IGFBPRP4; insulin-like growth factor binding protein related protein 4; insulin-like growth factor-binding protein-like 1; insulin-like growth factor-binding-related protein 4;
Immunogens
A synthesized peptide derived from human IGFBPL1, corresponding to a region within the internal amino acids.
Expressed at the highest level in both brain and testis, with lower levels in the prostate, bladder and lung.
- Q8WX77 IBPL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCLGAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity). May be a putative tumor suppressor protein.
Secreted.
Expressed at the highest level in both brain and testis, with lower levels in the prostate, bladder and lung.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.