IL1F5 Antibody - #DF2523
Product: | IL1F5 Antibody |
Catalog: | DF2523 |
Description: | Rabbit polyclonal antibody to IL1F5 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 17 kDa; 17kD(Calculated). |
Uniprot: | Q9UBH0 |
RRID: | AB_2839729 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2523, RRID:AB_2839729.
Fold/Unfold
AI413231; Family of interleukin 1 delta; FIL1; FIL1 delta; FIL1(DELTA); FIL1D; Fil1delta; I36RA_HUMAN; IL 1 delta; IL 1 related protein 3; IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta); Il 1h3; IL 1HY1; IL 1L1; IL 1ra homolog; IL 1ra homolog; IL1F5 (Canonical product IL 1F5a); IL 1RP3; IL-1 delta; IL-1-related protein 3; IL-1F5; IL-1HY1; IL-1L1; IL-1ra homolog 1; IL-1RP3; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; IL36RN; Interleukin 1 delta; Interleukin 1 family member 5 (delta); Interleukin 1 family member 5; Interleukin 1 HY1; Interleukin 1 like protein 1; Interleukin 1 receptor antagonist homolog 1; Interleukin 36 receptor antagonist; Interleukin-1 delta; Interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 receptor antagonist protein; MGC29840; PSORP; RP23-176J12.6;
Immunogens
A synthesized peptide derived from human IL1F5, corresponding to a region within the internal amino acids.
Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
- Q9UBH0 I36RA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Secreted.
Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
Belongs to the IL-1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.