IL1F8 Antibody - #DF2525

(1)   (3)  
Product: IL1F8 Antibody
Catalog: DF2525
Description: Rabbit polyclonal antibody to IL1F8
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 17 kDa; 19kD(Calculated).
Uniprot: Q9NZH7
RRID: AB_2839731

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
IL1F8 Antibody detects endogenous levels of total IL1F8.
RRID:
AB_2839731
Cite Format: Affinity Biosciences Cat# DF2525, RRID:AB_2839731.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2310043N20Rik; Family of interleukin 1 eta; FIL1 (ETA); FIL1; FIL1 eta; FIL1H; FILI-(ETA); IL 1F8 (FIL1 eta; IL 1F8; IL 1H2; IL-1 eta; IL-1F8; IL-1H2; IL1 ETA; IL1F8 (Canonical product IL 1F8a); IL1F8; IL1F8_HUMAN; IL1H2; IL36B; Interleukin 1 family, member 8 (eta); Interleukin 1 family, member 8; Interleukin 1 homolog 2; Interleukin 1 Superfamily e; Interleukin 36 beta; Interleukin-1 eta; Interleukin-1 family member 8; Interleukin-1 homolog 2; MGC126880; MGC126882; OTTMUSP00000012797; RP23-176J12.1;

Immunogens

Immunogen:
Uniprot:

Q9NZH7(IL36B_HUMAN) >>Visit HPA database.

Gene(ID):
IL36B(27177)
Expression:
Q9NZH7 IL36B_HUMAN:

Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin. Increased levels are not detected in inflamed joint tissue.

Sequence:
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM

PTMs - Q9NZH7 As Substrate

Site PTM Type Enzyme
T83 Phosphorylation

Research Backgrounds

Function:

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6.

PTMs:

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin. Increased levels are not detected in inflamed joint tissue.

Family&Domains:

Belongs to the IL-1 family.

References

1). Acitretin inhibits IL-17A-induced IL-36 expression in keratinocytes by down-regulating IκBζ. International Immunopharmacology, 2020 (PubMed: 31863918) [IF=4.8]

Application: IHC    Species: mouse    Sample: HaCaT cells

Fig. 2. |Immunohistochemical staining of IL-36β and IL-36γ in IMQ-induced psoriasis-like mice model (A, B). (A) Topical IMQ treatment successfully induced psoriasis-like skin lesion, and lesion severity of IMQ + Acitretin group seemed slightly alleviated in contrast to IMQ group. Immunohistochemical staining showed IL36β and IL-36γ expression had differential expression visually (×200).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.