IL1F8 Antibody - #DF2525
| Product: | IL1F8 Antibody |
| Catalog: | DF2525 |
| Description: | Rabbit polyclonal antibody to IL1F8 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 17 kDa; 19kD(Calculated). |
| Uniprot: | Q9NZH7 |
| RRID: | AB_2839731 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2525, RRID:AB_2839731.
Fold/Unfold
2310043N20Rik; Family of interleukin 1 eta; FIL1 (ETA); FIL1; FIL1 eta; FIL1H; FILI-(ETA); IL 1F8 (FIL1 eta; IL 1F8; IL 1H2; IL-1 eta; IL-1F8; IL-1H2; IL1 ETA; IL1F8 (Canonical product IL 1F8a); IL1F8; IL1F8_HUMAN; IL1H2; IL36B; Interleukin 1 family, member 8 (eta); Interleukin 1 family, member 8; Interleukin 1 homolog 2; Interleukin 1 Superfamily e; Interleukin 36 beta; Interleukin-1 eta; Interleukin-1 family member 8; Interleukin-1 homolog 2; MGC126880; MGC126882; OTTMUSP00000012797; RP23-176J12.1;
Immunogens
A synthesized peptide derived from human IL1F8, corresponding to a region within C-terminal amino acids.
Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin. Increased levels are not detected in inflamed joint tissue.
- Q9NZH7 IL36B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Research Backgrounds
Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6.
N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).
Secreted.
Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin. Increased levels are not detected in inflamed joint tissue.
Belongs to the IL-1 family.
References
Application: IHC Species: mouse Sample: HaCaT cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.