IL1FA Antibody - #DF2526
| Product: | IL1FA Antibody |
| Catalog: | DF2526 |
| Description: | Rabbit polyclonal antibody to IL1FA |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Horse, Rabbit, Dog |
| Mol.Wt.: | 16kDa; 17kD(Calculated). |
| Uniprot: | Q8WWZ1 |
| RRID: | AB_2839732 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2526, RRID:AB_2839732.
Fold/Unfold
family of interleukin 1-theta; FIL1 theta; FIL1T; FKSG75; IL 38; IL-1 theta; IL-1F10 (canonical form IL-1F10a); IL-1F10; IL-1HY2; IL1 theta; IL1F10; IL1FA_HUMAN; IL1HY2; Interleukin 1 family member 10 (theta); Interleukin 1 receptor antagonist FKSG75; Interleukin 1 receptor antagonist homolog 2; Interleukin 1 receptor antagonist like FIL1 theta; Interleukin-1 family member 10; Interleukin-1 HY2; Interleukin-1 theta; interleukin-38;
Immunogens
A synthesized peptide derived from human IL1FA, corresponding to a region within the internal amino acids.
Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.
- Q8WWZ1 IL1FA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.
Secreted.
Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.
Belongs to the IL-1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.