Product: IL25 Antibody
Catalog: DF2528
Description: Rabbit polyclonal antibody to IL25
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 20 kDa(Observed); 20kD(Calculated).
Uniprot: Q9H293
RRID: AB_2839734

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
IL25 Antibody detects endogenous levels of total IL25.
RRID:
AB_2839734
Cite Format: Affinity Biosciences Cat# DF2528, RRID:AB_2839734.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

IL 17E; IL 25; IL-17E; IL-25; IL17e; IL25; IL25_HUMAN; Interleukin 17E; Interleukin 25; Interleukin-17E; Interleukin-25; Interleukin17E; Interleukin25; OTTHUMP00000027946; OTTHUMP00000246238; UNQ3120/PRO10272;

Immunogens

Immunogen:

A synthesized peptide derived from human IL25, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9H293 IL25_HUMAN:

Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.

Description:
Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
Sequence:
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Research Backgrounds

Function:

Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.

Family&Domains:

Belongs to the IL-17 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). A co-delivery nanoplatform for Lignan-derived compound and perfluorocarbon tuning IL-25 secretion and oxygen level in tumor microenvironments for meliorative tumor radiotherapy. Nanoscale, 2021 (PubMed: 34477643) [IF=5.8]

Application: WB    Species: Mice    Sample: 3T3 cells

Fig. 5 (a) Apoptosis of 3T3 GFP , 4T1-3T3 GFP and 4T1 cells after incubation with free Q1 and various nanoparticles. (b) Quantitative analysis of the late apoptosis percentage in different cell groups. (c) The expression of IL25 in 3T3 cells after incubation with nanoparticles (** p < 0.01).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.