IL7 Antibody - #DF2531
| Product: | IL7 Antibody |
| Catalog: | DF2531 |
| Description: | Rabbit polyclonal antibody to IL7 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 20 kDa(Observed); 20kD(Calculated). |
| Uniprot: | P13232 |
| RRID: | AB_2839737 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2531, RRID:AB_2839737.
Fold/Unfold
IL 7; IL-7; Il7; IL7_HUMAN; Interleukin 7; Interleukin-7; LP-1; Lymphopoietin 1;
Immunogens
A synthesized peptide derived from human IL7, corresponding to a region within C-terminal amino acids.
- P13232 IL7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Research Backgrounds
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Secreted.
Belongs to the IL-7/IL-9 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.