IN35 Antibody - #DF2534
| Product: | IN35 Antibody |
| Catalog: | DF2534 |
| Description: | Rabbit polyclonal antibody to IN35 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 32 kDa(Observed); 32kD(Calculated). |
| Uniprot: | P80217 |
| RRID: | AB_2839740 |
Control Products
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2534, RRID:AB_2839740.
Fold/Unfold
FLJ21753; IFI 35; Ifi-35; Ifi35; IFP 35; IFP35; IN35; IN35_HUMAN; Interferon induced 35 kDa protein; Interferon-induced 35 kDa protein; OTTHUMP00000236626; OTTHUMP00000236627;
Immunogens
A synthesized peptide derived from human IN35, corresponding to a region within C-terminal amino acids.
In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
- P80217 IN35_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Research Backgrounds
Not yet known.
Nucleus.
Note: Nuclear following IFN treatment.
In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
Belongs to the NMI family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.