MAPRE2 Antibody - #DF2576
Product: | MAPRE2 Antibody |
Catalog: | DF2576 |
Description: | Rabbit polyclonal antibody to MAPRE2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 37 kDa; 37kD(Calculated). |
Uniprot: | Q15555 |
RRID: | AB_2839782 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2576, RRID:AB_2839782.
Fold/Unfold
APC binding protein EB1; APC binding protein EB2; APC-binding protein EB2; EB1; EB2; End binding protein 2; End-binding protein 2; H.sapiens mRNA for novel T cell activation protein; MAPRE2; MARE2_HUMAN; Microtubule associated protein RP/EB family member 2; Microtubule-associated protein RP/EB family member 2; RP1; T cell activation protein EB1 family;
Immunogens
Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
- Q15555 MARE2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15555 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S9 | Phosphorylation | Uniprot | |
T33 | Phosphorylation | Uniprot | |
S39 | Phosphorylation | Uniprot | |
Y49 | Phosphorylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K119 | Ubiquitination | Uniprot | |
S124 | Phosphorylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
K132 | Ubiquitination | Uniprot | |
K138 | Ubiquitination | Uniprot | |
K155 | Ubiquitination | Uniprot | |
K156 | Ubiquitination | Uniprot | |
Y162 | Phosphorylation | Uniprot | |
K165 | Sumoylation | Uniprot | |
K165 | Ubiquitination | Uniprot | |
Y167 | Phosphorylation | Uniprot | |
K193 | Ubiquitination | Uniprot | |
K194 | Ubiquitination | Uniprot | |
S200 | Phosphorylation | Uniprot | |
K207 | Ubiquitination | Uniprot | |
S208 | Phosphorylation | Uniprot | |
S209 | Phosphorylation | Uniprot | |
K213 | Ubiquitination | Uniprot | |
S216 | Phosphorylation | Uniprot | |
T217 | Phosphorylation | Uniprot | |
S219 | Phosphorylation | Uniprot | |
S222 | Phosphorylation | Uniprot | |
S223 | Phosphorylation | Uniprot | |
K225 | Acetylation | Uniprot | |
S228 | Phosphorylation | Uniprot | |
S232 | Phosphorylation | Uniprot | |
S234 | Phosphorylation | Uniprot | |
K235 | Ubiquitination | Uniprot | |
S236 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
K238 | Ubiquitination | Uniprot | |
K255 | Ubiquitination | Uniprot | |
K263 | Ubiquitination | Uniprot | |
K271 | Acetylation | Uniprot | |
K271 | Ubiquitination | Uniprot | |
Y327 | Phosphorylation | Uniprot |
Research Backgrounds
May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity).
Cytoplasm>Cytoskeleton.
Note: Associated with the microtubule network. Accumulates at the plus end of microtubules.
Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
Interacts with DCTN1. Interacts with APC (via C-terminal). Interacts with monomeric and polymerized tubulin. Interacts with SLAIN1.
Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
Belongs to the MAPRE family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.