NKIRAS2 Antibody - #DF2580
| Product: | NKIRAS2 Antibody |
| Catalog: | DF2580 |
| Description: | Rabbit polyclonal antibody to NKIRAS2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q9NYR9 |
| RRID: | AB_2839786 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2580, RRID:AB_2839786.
Fold/Unfold
DKFZP434N1526; I kappa B interacting Ras like protein 2; I-kappa-B-interacting Ras-like protein 2; Kappa B Ras protein 2; Kappa B-Ras protein 2; KappaB Ras2; KappaB-Ras2; KBRAS 2; KBRAS2; KBRS2_HUMAN; MGC74742; NF kappa B inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; NFKB inhibitor interacting Ras like 2; NFKB inhibitor interacting Ras like protein 2; NKIRAS 2; NKIRAS2;
Immunogens
A synthesized peptide derived from human NKIRAS2, corresponding to a region within C-terminal amino acids.
- Q9NYR9 KBRS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).
Cytoplasm.
Widely expressed.
In contrast to other members of the Ras family, the members of the KappaB-Ras subfamily do not contain the conserved Gly and Gln residues in positions 13 and 65, which are replaced by Ala and Leu residues, respectively, and are therefore similar to the constitutively active forms of oncogenic forms of Ras. This suggests that members of this family are clearly different from other small GTPases proteins.
Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.