NDFIP2 Antibody - #DF2596
Product: | NDFIP2 Antibody |
Catalog: | DF2596 |
Description: | Rabbit polyclonal antibody to NDFIP2 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Rabbit, Dog |
Mol.Wt.: | 36 kDa; 36kD(Calculated). |
Uniprot: | Q9NV92 |
RRID: | AB_2839802 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2596, RRID:AB_2839802.
Fold/Unfold
Ndfip2; NEDD4 family interacting protein 2; NEDD4 family-interacting protein 2; NEDD4 WW domain binding protein 5A; NEDD4 WW domain-binding protein 5A; NFIP2_HUMAN; Putative MAPK activating protein PM04/PM05/PM06/PM07; Putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF kappa B activating protein 413; Putative NF-kappa-B-activating protein 413;
Immunogens
A synthesized peptide derived from human NDFIP2, corresponding to a region within the internal amino acids.
- Q9NV92 NFIP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus and multivesicular body where it mediates KCNH2 degradation. May modulate EGFR signaling. Together with NDFIP1, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination (By similarity).
Ubiquitinated by NEDD4 and ITCH. Also ubiquitinated by NEDD4L. Ubiquitination by NEDD4 or NEDD4L does not affect turnover (By similarity).
Undergoes transient tyrosine-phosphorylation following EGF stimulation, most probably catalyzed by SRC. Phosphorylation on Tyr-151, Tyr-171 and Tyr-177 are dependent on the phosphorylation on Tyr-167. Also phosphorylated by LYN and FYN.
Endosome membrane>Multi-pass membrane protein. Golgi apparatus membrane. Endosome>Multivesicular body membrane.
Expressed in brain, lung, heart, skeletal muscle, kidney, liver and placenta.
The PPxY motifs are required for E3 ubiquitin-protein ligase activation and for ubiquitination.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.