DYNLL1 Antibody - #DF2630
Product: | DYNLL1 Antibody |
Catalog: | DF2630 |
Description: | Rabbit polyclonal antibody to DYNLL1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 10 kDa; 10kD(Calculated). |
Uniprot: | P63167 |
RRID: | AB_2839836 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2630, RRID:AB_2839836.
Fold/Unfold
8 kDa dynein light chain; 8kDLC; Cytoplasmic dynein light polypeptide; DLC1; DLC8; DNCL1; DNCLC1; DYL1_HUMAN; Dynein , cytoplasmic, light chain 1; Dynein light chain 1 cytoplasmic; Dynein light chain 1, cytoplasmic; Dynein light chain LC8 type 1; Dynein light chain LC8-type 1; Dynein, cytoplasmic, light polypeptide 1; Dynein, light chain, LC8-type 1; DYNLL1; HDLC1; LC8; LC8a; MGC126137; MGC126138; MGC72986; PIN; Protein inhibitor of neuronal nitric oxide synthase; Protein inhibitor of neuronal NOS;
Immunogens
A synthesized peptide derived from human DYNLL1, corresponding to a region within N-terminal amino acids.
- P63167 DYL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.
Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.
Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to it is phosphorylated at Ser-88 by PAK1, however, according to the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton. Nucleus. Mitochondrion.
Note: Upon induction of apoptosis translocates together with BCL2L11 to mitochondria.
Ubiquitous.
Belongs to the dynein light chain family.
Research Fields
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.