MAGEB5 Antibody - #DF2652
Product: | MAGEB5 Antibody |
Catalog: | DF2652 |
Description: | Rabbit polyclonal antibody to MAGEB5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 32 kDa; 32kD(Calculated). |
Uniprot: | Q9BZ81 |
RRID: | AB_2839858 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2652, RRID:AB_2839858.
Fold/Unfold
Cancer/testis antigen 3.3; Cancer/testis antigen family 3, member 3; CT3.3; MAGE family testis and tumor-specific protein; MAGE-B5; MAGE-B5 antigen; Melanoma antigen family B, 5; Melanoma-associated antigen B5;
Immunogens
A synthesized peptide derived from human MAGEB5, corresponding to a region within N-terminal amino acids.
Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins.
- Q9BZ81 MAGB5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSAGVFNAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQRILKEDMLKIVNPRYQNQFAEIHRRASEHIEVVFAVDLKEVNPTCHLYDLVSKLKLPNNGRIHVGKVLPKTGLLMTFLVVIFLKGNCANKEDTWKFLDMMQIYDGKKYYIYGEPRKLITQDFVRLTYLEYHQVPCSYPAHYQFLWGPRAYTETSKMKVLEYLAKVNDIAPGAFSSQYEEALQDEEESPSQRCSRNWHYCSGQDCLRAKFSSFSQPY
Research Backgrounds
Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.