CEACAM3 Antibody - #DF2694
Product: | CEACAM3 Antibody |
Catalog: | DF2694 |
Description: | Rabbit polyclonal antibody to CEACAM3 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 27 kDa; 27kD(Calculated). |
Uniprot: | P40198 |
RRID: | AB_2839900 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2694, RRID:AB_2839900.
Fold/Unfold
carcinoembryonic; Carcinoembryonic antigen CGM1; Carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; Carcinoembryonic antigen-related cell adhesion molecule 3; cd66 d; CD66d; CD66d antigen; CEA; CEACAM 3; CEACAM-3; Ceacam3; CEAM 3; CEAM-3; CEAM3; CEAM3_HUMAN; CGM1; Nonspecific cross reacting antigen; W264; W282;
Immunogens
A synthesized peptide derived from human CEACAM3, corresponding to a region within the internal amino acids.
CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney.
- P40198 CEAM3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS
Research Backgrounds
Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Tyrosine-phosphorylated in response to microbial binding. Tyr-230 and Tyr-241 are both required for phosphorylation to be detected.
Membrane>Single-pass type I membrane protein.
CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney.
The cytosolic domain is involved in S100A9 interaction.
Belongs to the immunoglobulin superfamily. CEA family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.