GPR1 Antibody - #DF2720
| Product: | GPR1 Antibody |
| Catalog: | DF2720 |
| Description: | Rabbit polyclonal antibody to GPR1 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
| Mol.Wt.: | 38 kDa,; 41kD(Calculated). |
| Uniprot: | P46091 |
| RRID: | AB_2839926 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2720, RRID:AB_2839926.
Fold/Unfold
G protein coupled receptor 1; G-protein coupled receptor 1; GPR1; GPR1_HUMAN; Probable G protein coupled receptor 1;
Immunogens
A synthesized peptide derived from human GPR1, corresponding to a region within C-terminal amino acids.
- P46091 GPR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Receptor for the inflammation-associated leukocyte chemoattractant chemerin/RARRES2 suggesting a role for this receptor in the regulation of inflammation. Receptor for TAFA1, mediates its effects on neuronal stem-cell proliferation and differentiation via the activation of ROCK/ERK and ROCK/STAT3 signaling pathway (By similarity).
(Microbial infection) Coreceptor for HIV-1.
Cell membrane>Multi-pass membrane protein.
Note: Internalizes in presence of its ligand, TAFA1.
Expressed in hippocampus.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.