GPR148 Antibody - #DF2726
Product: | GPR148 Antibody |
Catalog: | DF2726 |
Description: | Rabbit polyclonal antibody to GPR148 |
Application: | WB IHC |
Reactivity: | Human, Rat |
Mol.Wt.: | 61 kDa; 38kD(Calculated). |
Uniprot: | Q8TDV2 |
RRID: | AB_2839932 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2726, RRID:AB_2839932.
Immunogens
A synthesized peptide derived from human GPR148, corresponding to a region within the internal amino acids.
Expression restricted to nervous system and testis. Is also detected in several tumors types, most notably prostate cancer.
- Q8TDV2 GP148_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLSDLAYILLHMLISSSSLGGWELGRMACGILTDAVFAACTSTILSFTAIVLHTYLAVIHPLRYLSFMSHGAAWKAVALIWLVACCFPTFLIWLSKWQDAQLEEQGASYILPPSMGTQPGCGLLVIVTYTSILCVLFLCTALIANCFWRIYAEAKTSGIWGQGYSRARGTLLIHSVLITLYVSTGVVFSLDMVLTRYHHIDSGTHTWLLAANSEVLMMLPRAMLTYLYLLRYRQLLGMVRGHLPSRRHQAIFTIS
Research Backgrounds
Orphan receptor.
Cell membrane>Multi-pass membrane protein.
Expression restricted to nervous system and testis. Is also detected in several tumors types, most notably prostate cancer.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.