GPR20 Antibody - #DF2730
Product: | GPR20 Antibody |
Catalog: | DF2730 |
Description: | Rabbit polyclonal antibody to GPR20 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 42 kDa, 55 kDa; 39kD(Calculated). |
Uniprot: | Q99678 |
RRID: | AB_2839936 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2730, RRID:AB_2839936.
Fold/Unfold
G protein coupled receptor 20; G-protein coupled receptor 20; Gpr20; GPR20_HUMAN;
Immunogens
Ubiquitous with highest levels in intestinal tissues. In the brain detected in thalamus, putamen, and caudate, but not in frontal cortex, pons and hypothalamus.
- Q99678 GPR20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
PTMs - Q99678 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y149 | Phosphorylation | Uniprot | |
S158 | Phosphorylation | Uniprot | |
S322 | Phosphorylation | Uniprot | |
S327 | Phosphorylation | Uniprot |
Research Backgrounds
Orphan receptor with constitutive G(i) signaling activity that activate cyclic AMP.
Cell membrane>Multi-pass membrane protein.
Ubiquitous with highest levels in intestinal tissues. In the brain detected in thalamus, putamen, and caudate, but not in frontal cortex, pons and hypothalamus.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.