GPR35 Antibody - #DF2741
Product: | GPR35 Antibody |
Catalog: | DF2741 |
Description: | Rabbit polyclonal antibody to GPR35 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse |
Mol.Wt.: | 34 kDa; 34kD(Calculated). |
Uniprot: | Q9HC97 |
RRID: | AB_2839947 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2741, RRID:AB_2839947.
Fold/Unfold
G protein coupled receptor 35; G protein coupled receptor 35; GPR 35; GPR35; KYNA receptor; Kynurenic acid receptor; Probable G protein coupled receptor 35; Probable G protein coupled receptor GPR35;
Immunogens
A synthesized peptide derived from human GPR35, corresponding to a region within the internal amino acids.
- Q9HC97 GPR35_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Cell membrane>Multi-pass membrane protein.
Note: Internalized to the cytoplasm after exposure to kynurenic acid.
Predominantly expressed in immune and gastrointestinal tissues.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.