Product: GPR43 Antibody
Catalog: DF2746
Description: Rabbit polyclonal antibody to GPR43
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human
Mol.Wt.: 37 kDa(Observed); 37kD(Calculated).
Uniprot: O15552
RRID: AB_2839952

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
GPR43 Antibody detects endogenous levels of total GPR43.
RRID:
AB_2839952
Cite Format: Affinity Biosciences Cat# DF2746, RRID:AB_2839952.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Fatty acid receptor 2; FFA2R; Ffar2; FFAR2_HUMAN; free fatty acid activated receptor 2; Free fatty acid receptor 2; G protein coupled receptor 43; G protein-coupled receptor 43; G-protein coupled receptor 43; GPR 43; GPR43;

Immunogens

Immunogen:

A synthesized peptide derived from human GPR43, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O15552 FFAR2_HUMAN:

Expressed at relatively high levels in peripheral blood leukocytes and, to lesser extent, in spleen.

Description:
Receptor for short chain fatty acids through a G(i)-protein-mediated inhibition of adenylyl cyclase and elevation of intracellular calcium. The rank order of potency for agonists of this receptor is acetate= propionate = butyrate > pentanoate = formate.
Sequence:
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE

Research Backgrounds

Function:

G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules. That G protein-coupled receptor is probably coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins but also to the Gq family. Its activation results in the formation of inositol 1,4,5-trisphosphate, the mobilization of intracellular calcium, the phosphorylation of the MAPK3/ERK1 and MAPK1/ERK2 kinases and the inhibition of intracellular cAMP accumulation. May play a role in glucose homeostasis by regulating the secretion of GLP-1, in response to short-chain fatty acids accumulating in the intestine. May also regulate the production of LEP/Leptin, a hormone acting on the central nervous system to inhibit food intake. Finally, may also regulate whole-body energy homeostasis through adipogenesis regulating both differentiation and lipid storage of adipocytes. In parallel to its role in energy homeostasis, may also mediate the activation of the inflammatory and immune responses by SCFA in the intestine, regulating the rapid production of chemokines and cytokines. May also play a role in the resolution of the inflammatory response and control chemotaxis in neutrophils. In addition to SCFAs, may also be activated by the extracellular lectin FCN1 in a process leading to activation of monocytes and inducing the secretion of interleukin-8/IL-8 in response to the presence of microbes. Among SCFAs, the fatty acids containing less than 6 carbons, the most potent activators are probably acetate, propionate and butyrate. Exhibits a SCFA-independent constitutive G protein-coupled receptor activity.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at relatively high levels in peripheral blood leukocytes and, to lesser extent, in spleen.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

References

1). Sodium butyrate reduces high-fat diet-induced non-alcoholic steatohepatitis through upregulation of hepatic GLP-1R expression. Experimental & Molecular Medicine, 2018 (PubMed: 30510243) [IF=9.5]

Application: WB    Species: human    Sample: HepG2 cells

Figure S2. | GPR43 or GPR109a expression in HepG2 cells was successfully knocked out by siRNA. A. GPR43 protein expression in HepG2 cells was significantly down-regulated by siRNA-GPR43 when compared with the normal control. B. GPR109a protein expression in HepG2 cells was significantly down-regulated by siRNA-GPR109a when compared with the normal control. The data represent the mean ± S.E.M. vs. control *P < 0.05, **P < 0.01 and ***P < 0.001.

2). Gut microbiome and serum short-chain fatty acids are associated with responses to chemo- or targeted therapies in Chinese patients with lung cancer. Frontiers in microbiology, 2023 (PubMed: 37564290) [IF=5.2]

Application: WB    Species: human    Sample: LC cells

Figure 5. Isobutyric acid regulated G protein-coupled receptor (GPCR) expression and histone acetyltransferase (HAT) activity. For the expression of GPCRs, the results of RT-qPCR (A), Western blot (B), and immunocytochemical staining (C) showed that GPR41, GPR43, and GPRC5A expressions were significantly higher, while PAR1 expression was significantly lower in isobutyric acid treatment group (1.85 mM) than the control groups (control and NC). Immunofluorescence staining (D) identified the expression location of GPCRs. For the expression of acetyl-histones and histones, the results of Western blot (E) and immunocytochemical staining (F) showed that acetyl-histone H3 and H4 expressions were significantly higher in the isobutyric acid treatment group (1.85 mM) than the control groups (control and NC), whereas Western blot results showed that there was no significant difference of the expression of histone H3 and H4 between isobutyric acid treatment group and the control groups. Immunofluorescence staining (G) identified the expression location of acetyl-histone H3 and H4. HAT activity assay (H) results showed that HAT activity was increased in the isobutyric acid treatment group (1.85mM) than in the control groups (control and NC). P-values were calculated using Student's t-tests. ns: no significance; *p < 0.05; **p < 0.01; ***p < 0.001. All experiments were repeated three times. NC, negative control (0mM).

Application: IF/ICC    Species: human    Sample: LC cells

Figure 5. Isobutyric acid regulated G protein-coupled receptor (GPCR) expression and histone acetyltransferase (HAT) activity. For the expression of GPCRs, the results of RT-qPCR (A), Western blot (B), and immunocytochemical staining (C) showed that GPR41, GPR43, and GPRC5A expressions were significantly higher, while PAR1 expression was significantly lower in isobutyric acid treatment group (1.85 mM) than the control groups (control and NC). Immunofluorescence staining (D) identified the expression location of GPCRs. For the expression of acetyl-histones and histones, the results of Western blot (E) and immunocytochemical staining (F) showed that acetyl-histone H3 and H4 expressions were significantly higher in the isobutyric acid treatment group (1.85 mM) than the control groups (control and NC), whereas Western blot results showed that there was no significant difference of the expression of histone H3 and H4 between isobutyric acid treatment group and the control groups. Immunofluorescence staining (G) identified the expression location of acetyl-histone H3 and H4. HAT activity assay (H) results showed that HAT activity was increased in the isobutyric acid treatment group (1.85mM) than in the control groups (control and NC). P-values were calculated using Student's t-tests. ns: no significance; *p < 0.05; **p < 0.01; ***p < 0.001. All experiments were repeated three times. NC, negative control (0mM).

Application: IHC    Species: human    Sample: LC cells

Figure 5. Isobutyric acid regulated G protein-coupled receptor (GPCR) expression and histone acetyltransferase (HAT) activity. For the expression of GPCRs, the results of RT-qPCR (A), Western blot (B), and immunocytochemical staining (C) showed that GPR41, GPR43, and GPRC5A expressions were significantly higher, while PAR1 expression was significantly lower in isobutyric acid treatment group (1.85 mM) than the control groups (control and NC). Immunofluorescence staining (D) identified the expression location of GPCRs. For the expression of acetyl-histones and histones, the results of Western blot (E) and immunocytochemical staining (F) showed that acetyl-histone H3 and H4 expressions were significantly higher in the isobutyric acid treatment group (1.85 mM) than the control groups (control and NC), whereas Western blot results showed that there was no significant difference of the expression of histone H3 and H4 between isobutyric acid treatment group and the control groups. Immunofluorescence staining (G) identified the expression location of acetyl-histone H3 and H4. HAT activity assay (H) results showed that HAT activity was increased in the isobutyric acid treatment group (1.85mM) than in the control groups (control and NC). P-values were calculated using Student's t-tests. ns: no significance; *p < 0.05; **p < 0.01; ***p < 0.001. All experiments were repeated three times. NC, negative control (0mM).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.