GPR56 Antibody - #DF2753
| Product: | GPR56 Antibody |
| Catalog: | DF2753 |
| Description: | Rabbit polyclonal antibody to GPR56 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Monkey |
| Prediction: | Pig, Horse, Sheep |
| Mol.Wt.: | 78 kDa,95kDa; 78kD(Calculated). |
| Uniprot: | Q9Y653 |
| RRID: | AB_2839959 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2753, RRID:AB_2839959.
Fold/Unfold
7 transmembrane protein with no EGF like N terminal domains 1; BFPP; DKFZp781L1398; EGF TM7 like; G protein coupled receptor 56; G-protein coupled receptor 56; GPR 56; Gpr56; GPR56_HUMAN; Polymicrogyria bilateral frontoparietal; Protein TM7XN1; TM7LN4; TM7XN1; TM7XN1 protein;
Immunogens
Widely distributed with highest levels found in thyroid gland, brain and heart. Expressed in a great number of tumor cells. Expression is down-regulated in different tumors from highly metastatic cells.
- Q9Y653 AGRG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y653 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T51 | O-Glycosylation | Uniprot | |
| S187 | Phosphorylation | Uniprot | |
| S201 | Phosphorylation | Uniprot | |
| T343 | Phosphorylation | Uniprot | |
| S670 | Phosphorylation | Uniprot | |
| K673 | Ubiquitination | Uniprot | |
| S676 | Phosphorylation | Uniprot | |
| S678 | Phosphorylation | Uniprot | |
| S684 | Phosphorylation | Uniprot | |
| S685 | Phosphorylation | Uniprot | |
| S687 | Phosphorylation | Uniprot | |
| T688 | Phosphorylation | Uniprot | |
| S689 | Phosphorylation | Uniprot | |
| S690 | Phosphorylation | Uniprot | |
| S691 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor involved in cell adhesion and probably in cell-cell interactions. Mediates cell matrix adhesion in developing neurons and hematopoietic stem cells. Receptor for collagen III/COL3A1 in the developing brain and involved in regulation of cortical development, specifically in maintenance of the pial basement membrane integrity and in cortical lamination (By similarity). Binding to the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway by coupling to GNA13 and possibly GNA12. Plays a role in the maintenance of hematopoietic stem cells and/or leukemia stem cells in bone marrow niche (By similarity). Plays a critical role in cancer progression by inhibiting VEGFA production threreby inhibiting angiogenesis through a signaling pathway mediated by PRKCA. Plays an essential role in testis development (By similarity).
Plays a critical role in cancer progression by activating VEGFA production and angiogenesis through a signaling pathway mediated by PRKCA.
Autoproteolytically cleaved into 2 fragments; the large extracellular N-terminal fragment (ADGRG1 NT) and the membrane-bound C-terminal fragment (ADGRG1 CT) predominantly remain associated and non-covalently linked. Shedding to yield the secreted ADGRG1 N-terminal fragment seems to involve metalloprotease(s).
N-glycosylated. Contains sialic acid residues.
Ubiquitinated. Undergoes polyubiquitination upon activation.
Cell membrane>Multi-pass membrane protein.
Secreted.
Membrane raft.
Note: Interaction with its ligand COL3A1 leads to the release of ADGRG1 NT from the membrane and triggers the association of ADGRG1 CT with lipid rafts.
Widely distributed with highest levels found in thyroid gland, brain and heart. Expressed in a great number of tumor cells. Expression is down-regulated in different tumors from highly metastatic cells.
Heterodimer of 2 chains generated by proteolytic processing; the large extracellular N-terminal fragment (ADGRG1 NT) and the membrane-bound C-terminal fragment (ADGRG1-CT) predominantly remain associated and non-covalently linked. ADGRG1 NT self-associates in a trans-trans manner; the homophilic interaction enhances receptor signaling. ADGRG1-CT interacts with ARRB2; the interaction is impaired by ADGRG1 NT. Interacts with TGM2; TGM2 probably is not a ADGRG1 ligand and the interaction is reported controversial. Part of a GPCR-tetraspanin complex at least consisting of ADGRG1, CD81, eventually CD9, and GNA11 in which CD81 is enhancing the association of ADGRG1 with GNA11. Interacts with heparin; leading to the reduction of ADGRG1 shedding. Interacts with COL3A1.
Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.