GPR80/GPR99 Antibody - #DF2765
| Product: | GPR80/GPR99 Antibody |
| Catalog: | DF2765 |
| Description: | Rabbit polyclonal antibody to GPR80/GPR99 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 38 kDa; 38kD(Calculated). |
| Uniprot: | Q96P68 |
| RRID: | AB_2839971 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2765, RRID:AB_2839971.
Fold/Unfold
2 oxoglutarate receptor 1; 2-oxoglutarate receptor 1; aKGR; Alpha ketoglutarate receptor 1; Alpha-ketoglutarate receptor 1; G Protein Coupled Receptor 80; G Protein Coupled Receptor 99; G-protein coupled receptor 80; G-protein coupled receptor 99; GPR80; GPR99; MGC119206; MGC119207; MGC119208; OXGR 1; Oxgr1; OXGR1_HUMAN; Oxoglutarate (alpha ketoglutarate) receptor 1; Oxoglutarate receptor 1; P2RY15; P2Y like GPCR; P2Y like nucleotide receptor; P2Y purinoceptor 15; P2Y-like GPCR; P2Y-like nucleotide receptor; P2Y15;
Immunogens
A synthesized peptide derived from human GPR80/GPR99, corresponding to a region within the internal amino acids.
Detected in kidney and, to a lower extent, in placenta. Not detected in brain tissues including the frontal cortex, caudate putamen, thalamus, hypothalamus, hippocampus or pons.
- Q96P68 OXGR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Receptor for alpha-ketoglutarate. Seems to act exclusively through a G(q)-mediated pathway (By similarity).
Cell membrane>Multi-pass membrane protein.
Detected in kidney and, to a lower extent, in placenta. Not detected in brain tissues including the frontal cortex, caudate putamen, thalamus, hypothalamus, hippocampus or pons.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.