Product: GPR84 Antibody
Catalog: DF2769
Description: Rabbit polyclonal antibody to GPR84
Application: WB IHC
Cited expt.: IHC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 38 kDa; 44kD(Calculated).
Uniprot: Q9NQS5
RRID: AB_2839975

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(89%), Rabbit(89%), Dog(100%)
Clonality:
Polyclonal
Specificity:
GPR84 Antibody detects endogenous levels of total GPR84.
RRID:
AB_2839975
Cite Format: Affinity Biosciences Cat# DF2769, RRID:AB_2839975.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EX 33; EX33; G protein coupled receptor 84; G protein coupled receptor EX 33; G protein coupled receptor EX33; G-protein coupled receptor 84; GPCR 4; GPCR4; GPR 84; GPR84; GPR84_HUMAN; Inflammation related G protein coupled receptor EX 33; Inflammation related G protein coupled receptor EX33; Inflammation-related G-protein coupled receptor EX33;

Immunogens

Immunogen:

A synthesized peptide derived from human GPR84, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9NQS5 GPR84_HUMAN:

Expressed predominantly in hematopoietic tissues. High levels detected in the bone marrow and lower levels in the peripheral leukocytes and lung. Also expressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta and intestine. Within the leukocyte population expression is higher in neutrophils and eosinophils relative to T- or B-lymphocytes.

Description:
Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system.
Sequence:
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Sheep
89
Rabbit
89
Xenopus
67
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed predominantly in hematopoietic tissues. High levels detected in the bone marrow and lower levels in the peripheral leukocytes and lung. Also expressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta and intestine. Within the leukocyte population expression is higher in neutrophils and eosinophils relative to T- or B-lymphocytes.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

References

1). Novel macrophage-related gene prognostic index for glioblastoma associated with M2 macrophages and T cell dysfunction. Frontiers in Immunology, 2022 (PubMed: 36177003) [IF=5.7]

Application: IHC    Species: Human    Sample:

Figure 2 Prognostic significance of MRGPI-based groups. (A) Multivariate Cox regression analysis of 13 differentially expressed macrophage-related hub genes. (B) Cox regression analysis of the MRGPI and clinicopathological parameters based on the TCGA cohort. Covariates including age, gender, IDH mutation, ATRX mutation, MGMT promoter methylation status, TERT promoter mutation, and MRGPI were included in the initial univariate Cox regression. Covariates with p-values less than 0.01 were further included in the multivariate Cox model. (C, D) K-M analysis of the survival and tumor progression-free interval differences between MRGPI-based groups based on TCGA, CGGA325, and Gravendeel GBM cohorts. (E, F) Immunohistochemical staining of five genes at the protein level. The tissue was divided into core of the tumor (Tumor) and the margin containing infiltrating tumor cells (Peritumor) in three patients with a pathological diagnosis of GBM. The intensity of staining for the proteins encoded by these genes at the tissue level ranged from negative to positive, with E showing genes with significantly higher IHC scores in the tumor core. The IHC scores of the five genes were shown in F (Scale bar, 100μm). (G) Pan-cancer-based MRGPI prognostic significance. Samples were split into early (PFI < 6 months) and late (PFI > 12 months) relapse groups based on PFI. OV, Ovarian serous cystadenocarcinoma; LUAD, Lung adenocarcinoma; LUSC, Lung squamous cell carcinoma; PRAD, Prostate adenocarcinoma; BLCA, Bladder urothelial carcinoma; TGCT, Testicular germ cell tumors; ESCA, Esophageal carcinoma; PAAD, Pancreatic adenocarcinoma; LIHC, Liver hepatocellular carcinoma; KIRP, Kidney renal papillary cell carcinoma; SARC, Sarcoma; BRCA, Breast invasive carcinoma; MESO, Mesothelioma; COAD, Colon adenocarcinoma; STAD, Stomach adenocarcinoma; SKCM, Skin cutaneous melanoma; CHOL, Cholangiocarcinoma; KIRC, Kidney renal clear cell carcinoma; THCA, Thyroid carcinoma; UCEC, Uterine corpus endometrial carcinoma; CESC, Cervical squamous cell carcinoma and endocervical adenocarcinoma; HNSC, Head and neck squamous cell carcinoma; READ, Rectum adenocarcinoma; LGG, Lower grade glioma; KICH, Kidney chromophobe; UCS, Uterine carcinosarcoma; ACC, Adrenocortical carcinoma; PCPG, Pheochromocytoma and paraganglioma; UVM, Uveal melanoma. ***p < 0.001. ns, non significant.

2). Synthetic GPR84 Agonists in Colorectal Cancer: Effective in THP-1 Cells but Ineffective in BMDMs and MC38 Mouse Tumor Models. International journal of molecular sciences, 2025 (PubMed: 39859206) [IF=5.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.