OR4C45 Antibody - #DF2826
(1)
| Product: | OR4C45 Antibody |
| Catalog: | DF2826 |
| Description: | Rabbit polyclonal antibody to OR4C45 |
| Application: | WB IHC |
| Reactivity: | Human |
| Mol.Wt.: | 35 kDa; 35kD(Calculated). |
| Uniprot: | A6NMZ5 |
| RRID: | AB_2840032 |
Product Info
Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Reactivity:
Human
Clonality:
Polyclonal
Specificity:
OR4C45 Antibody detects endogenous levels of total OR4C45.
RRID:
AB_2840032
Cite Format: Affinity Biosciences Cat# DF2826, RRID:AB_2840032.
Cite Format: Affinity Biosciences Cat# DF2826, RRID:AB_2840032.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:
Fold/Unfold
Olfactory receptor family 4 subfamily C member 45;
Immunogens
Immunogen:
A synthesized peptide derived from human OR4C45, corresponding to a region within the internal amino acids.
Uniprot:
Sequence:
- A6NMZ5 O4C45_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNNVIEFILLGLTHNPELQKFLFVMFLITYLITLAGNLFISVIIFISPALGSPMYSFPSYLFIIDIFCSSSIAPKMNFDLISEKNTISFNGCMTQLFTEHFFYYYYYYTLTEIILLSVMAYDHYVAIRKPLHYATIMSQPMCGFLMVVAGILGFVHGGIQTLFIAQLPFCGPNVINHFMCDLVPLLELACTDTHTLGPLIAANSGSLCFLIFSMLVASYVIILCFLRTHSSEGRRKALSSCASHIFIVILFFVPFSYLYLRPTSFPTDKAVTVFCTLFTPMLNPLIYTLKNKEVKNVIKKLWKQIMTTDDK
Research Backgrounds
Function:
Odorant receptor.
Subcellular Location:
Cell membrane>Multi-pass membrane protein.
Family&Domains:
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.