MMP19 Antibody - #AF0215

(2)   (7)  
Product: MMP19 Antibody
Catalog: AF0215
Description: Rabbit polyclonal antibody to MMP19
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse
Prediction: Rabbit
Mol.Wt.: 57kDa; 57kD(Calculated).
Uniprot: Q99542
RRID: AB_2833345

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Rabbit(82%)
Clonality:
Polyclonal
Specificity:
MMP19 Antibody detects endogenous levels of total MMP19.
RRID:
AB_2833345
Cite Format: Affinity Biosciences Cat# AF0215, RRID:AB_2833345.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Matrix metalloproteinase 18; Matrix metalloproteinase 19; Matrix metalloproteinase RASI; Matrix metalloproteinase-18; Matrix metalloproteinase-19; MMP 18; MMP 19; MMP-18; MMP-19; MMP18; MMP19; MMP19_HUMAN; RASI 1; RASI; RASI1;

Immunogens

Immunogen:

A synthesized peptide derived from human MMP19, corresponding to a region within N-terminal amino acids.

Uniprot:

Q99542(MMP19_HUMAN) >>Visit HPA database.

Gene(ID):
MMP19(4327)
Expression:
Q99542 MMP19_HUMAN:

Expressed in mammary gland, placenta, lung, pancreas, ovary, small intestine, spleen, thymus, prostate, testis colon, heart and blood vessel walls. Not detected in brain and peripheral blood leukocytes. Also expressed in the synovial fluid of normal and rheumatoid patients (PubMed:8920941).

Description:
MMP19 Endopeptidase that degrades various components of the extracellular matrix, such as aggrecan and cartilage oligomeric matrix protein (comp), during development, haemostasis and pathological conditions (arthritic disease). May also play a role in neovascularization or angiogenesis. Hydrolyzes collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin
Sequence:
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
82
Dog
77
Horse
69
Bovine
69
Sheep
69
Xenopus
57
Pig
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Endopeptidase that degrades various components of the extracellular matrix, such as aggrecan and cartilage oligomeric matrix protein (comp), during development, haemostasis and pathological conditions (arthritic disease). May also play a role in neovascularization or angiogenesis. Hydrolyzes collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin.

PTMs:

Activated by autolytic cleavage after Lys-97.

Tyrosine phosphorylated by PKDCC/VLK.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in mammary gland, placenta, lung, pancreas, ovary, small intestine, spleen, thymus, prostate, testis colon, heart and blood vessel walls. Not detected in brain and peripheral blood leukocytes. Also expressed in the synovial fluid of normal and rheumatoid patients.

Family&Domains:

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

References

1). Endothelial cell-derived MMP19 promotes pulmonary fibrosis by inducing E(nd)MT and monocyte infiltration. Cell communication and signaling : CCS, 2023 (PubMed: 36915092) [IF=8.4]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 1 MMP19 is significantly upregulated in the endothelial cells of IPF patients and BLM-induced fibrotic mouse lungs. A Immunohistochemistry analysis for MMP19 in IPF lung tissue. B MMP19 expression level in lung BAL fluid of IPF and normal control. C qRT-PCR was performed for the expression of MMP19 in lung homogenates from mice treated with saline or BLM. D Immunoblot analysis of MMP19 in lung homogenates from mice treated with saline or BLM. E Immunohistochemical evaluation of MMP19 in saline control or BLM-challenged mice lung. F Immunohistochemistry analysis for MMP19 in endothelial cells of IPF and BLM-challenged mice lung sections. G Immunofluorescence analysis for CD31 (pink) and MMP19 (green) in endothelial cells in mice treated with saline control or BLM

Application: WB    Species: Mouse    Sample:

Fig. 1 MMP19 is significantly upregulated in the endothelial cells of IPF patients and BLM-induced fibrotic mouse lungs. A Immunohistochemistry analysis for MMP19 in IPF lung tissue. B MMP19 expression level in lung BAL fluid of IPF and normal control. C qRT-PCR was performed for the expression of MMP19 in lung homogenates from mice treated with saline or BLM. D Immunoblot analysis of MMP19 in lung homogenates from mice treated with saline or BLM. E Immunohistochemical evaluation of MMP19 in saline control or BLM-challenged mice lung. F Immunohistochemistry analysis for MMP19 in endothelial cells of IPF and BLM-challenged mice lung sections. G Immunofluorescence analysis for CD31 (pink) and MMP19 (green) in endothelial cells in mice treated with saline control or BLM

Application: IHC    Species: Mouse    Sample:

Fig. 6 MMP19 induces monocyte infiltration is associated with the SDF1/CXCR4 axis. A Western blot was performed for SDF1 in lung homogenates that MMP19WT and MMP19E213A-AAV-infected mice treated with saline control or BLM. B Representative micrographs of immunohistochemical staining for SDF1 and CXCR4 in lung sections (up and middle), and CXCR4 in blood vessels (bottom). C SDF1 expression level in lung endothelial cells of mice treated with saline and BLM. D Expression relevance between MMP19 and SDF1 in lung endothelial cells of mice treated with saline and BLM. E Expression relevance between MMP19 and CXCR4 in IPF lung tissues. F MMP19 and SDF1 were assessed by immunoprecipitation in HPMECs. G Immunofluorescence was performed to localize MMP19 (red) and SDF-1 (green) in endothelial cells in mice and IPF lung tissues. H THP-1 cell adhesion to HPMECs was assessed using an inverted fluorescence microscope. I Lung hydroxyproline levels in MMP19WT-AAV-infected mice treated with BLM and AMD3100. n = 5 in all groups. J Micrographs of immunohistochemical staining of lung sections for EMR1. K Representative micrographs of H&E staining and Masson’s trichrome of lung sections
2). The antitumor effects of lupenone on colon cancer and its mechanistic insights. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 40669211) [IF=6.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.