Product: AP2 alpha/beta Antibody
Catalog: AF0535
Description: Rabbit polyclonal antibody to AP2 alpha/beta
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 49kDa; 48kD,50kD(Calculated).
Uniprot: P05549 | Q92481
RRID: AB_2834124

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(83%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(83%)
Clonality:
Polyclonal
Specificity:
AP2 alpha/beta Antibody detects endogenous levels of total AP2 alpha/beta.
RRID:
AB_2834124
Cite Format: Affinity Biosciences Cat# AF0535, RRID:AB_2834124.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activating enhancer binding protein 2 alpha; Activating enhancer-binding protein 2-alpha; Activator protein 2; AP 2 transcription factor; AP 2alpha; AP-2; AP-2 transcription factor; AP2; AP2 Transcription Factor; AP2-alpha; AP2A_HUMAN; AP2TF; BOFS; FLJ51761; TFAP 2; TFAP 2A; TFAP2; TFAP2A; Transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); Transcription factor AP-2-alpha; Transcription factor AP2 alpha; Activating enhancer binding protein 2 beta; Activating enhancer-binding protein 2-beta; AP 2B; AP2 B; AP2-beta; AP2B; AP2B_HUMAN; AP2beta; MGC21381; OTTHUMP00000039925; PDA2; TFAP 2B; Tfap2b; Transcription factor AP 2 beta; Transcription factor AP-2-beta; Transcription factor AP2 beta;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
AP-2 alpha Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.
Sequence:
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
83
Zebrafish
83
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P05549/Q92481 As Substrate

Site PTM Type Enzyme
K10 Sumoylation
K10 Ubiquitination
Y73 Phosphorylation
S119 Phosphorylation
K177 Sumoylation
K177 Ubiquitination
S181 Phosphorylation
K184 Ubiquitination
S185 Phosphorylation
S187 Phosphorylation
K197 Ubiquitination
S219 Phosphorylation P54646 (PRKAA2)
S223 Phosphorylation
S225 Phosphorylation
K226 Ubiquitination
K228 Ubiquitination
S239 Phosphorylation P17612 (PRKACA)
S258 Phosphorylation Q15139 (PRKD1)
K268 Ubiquitination
K271 Ubiquitination
K282 Ubiquitination
K315 Ubiquitination
S326 Phosphorylation Q15139 (PRKD1)
K335 Ubiquitination
K411 Ubiquitination
S428 Phosphorylation
S429 Phosphorylation P68400 (CSNK2A1)
Site PTM Type Enzyme
S3 Phosphorylation
K15 Ubiquitination
K21 Sumoylation
S120 Phosphorylation
S242 Phosphorylation
S244 Phosphorylation
K245 Ubiquitination
S258 Phosphorylation
K301 Ubiquitination
K354 Ubiquitination

Research Backgrounds

Function:

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.

PTMs:

Sumoylated on Lys-10; which inhibits transcriptional activity.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with CITED4. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis. Interacts with KCTD1; this interaction represses transcription activation. Interacts (via C-terminus) with CITED2 (via C-terminus); the interaction stimulates TFAP2A-transcriptional activation. Interacts (via N-terminus) with EP300 (via N-terminus); the interaction requires CITED2. Interacts with KCTD15; this interaction inhibits TFAP2A transcriptional activation.

Family&Domains:

The PPxY motif mediates interaction with WWOX.

Belongs to the AP-2 family.

Function:

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-beta appears to be required for normal face and limb development and for proper terminal differentiation and function of renal tubular epithelia.

PTMs:

Sumoylated on Lys-21; which inhibits transcriptional activity.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with CITED4. Interacts with UBE2I. Interacts with KCTD1; this interaction represses transcription activation. Interacts with CITED2 (via C-terminus); the interaction stimulates TFAP2B-transcriptional activity.

Family&Domains:

Belongs to the AP-2 family.

References

1). Yang Y et al. E4BP4 mediates glucocorticoid-regulated adipogenesis through COX2. MOLECULAR AND CELLULAR ENDOCRINOLOGY 2017 Jul 15;450:43-53 (PubMed: 28416324) [IF=4.1]

Application: WB    Species: mouse    Sample:

Fig. 3. E4BP4 mediates the actions of glucocorticoid in adipocyte formation. (a, b) The adipogenic phenotypes of 3T3-L1 cells transfected with pCDNA3.1-E4BP4 or control after induction by MI for 6 days were assessed by ORO staining. (b) Triglyceride accumulation was quantified and normalized to protein amount. (c) The mRNA levels of PPARg2, aP2, adiponectin, and LPL at day 6 were detected by qPCR. (d) The protein levels of PPARg and aP2 at day 6 were measured by Western blot. (e) The adipogenic phenotypes of 3T3-L1 cells transfected with siE4BP4 or control after being induced by DEX only for 6 days were assessed by ORO staining. (f) Triglyceride accumulation was quantified and normalized to protein amount. (g) qPCR analysis of PPARg2, aP2, adiponectin, and LPL. (h) Western blot analysis of PPARg and aP2. The results are expressed as mean ± SD (n ¼ 3); *P < 0.05 and **P < 0.01 indicate significant difference from the control.

2). Qian Y et al. Autologous decellularized extracellular matrix promotes adipogenic differentiation of adipose derived stem cells in low serum culture system by regulating the ERK1/2-PPARγ pathway. Adipocyte 2021 Dec;10(1):174-188. (PubMed: 33825675) [IF=3.3]

Application: WB    Species: Human    Sample: ADSCs

Figure 7. Effects of d-ECM on the ERK1/2-PPARγ pathway and the expression of adipocyte secreting factors ADIPOQ and aP2 in the fully differentiated ADSCs. After 3-days treatments and 14-days adipogenic induction, ADSCs at the 5th passage were collected and used for Western blotting analysis (a). Protein levels of ERK1/2 (b), p-ERK1/2 (c), PPARγ (d), p-PPARγ (e), ADIPOQ (f) and aP2 (g) were examined. GAPDH demonstrated the equal loading of protein samples. N = 3. *, p < 0.05, vs. 10% FBS group; **, p < 0.01, vs. 10% FBS group; #, p < 0.05, vs. 2% FBS group; ##, p < 0.01, vs. 2% FBS group; $, p < 0.05, vs. 2% FBS + d-ECM group; $$, p < 0.01, vs. 2% FBS + d-ECM group. ADIPOQ, adiponectin; aP2, adipocyte fatty-acid binding protein

3). Wu et al. Pancreatic Cancer-Derived Exosomes Promote the Proliferation, Invasion, and Metastasis of Pancreatic Cancer by the miR-3960/TFAP2A Axis. Journal of Oncology 2022 Oct 15;2022:3590326. (PubMed: 36284637)

Application: WB    Species: Mice    Sample: lung

Figure 6 The effect of tumor-derived exosomes on miR-3960-overexpressed pancreatic cancer (PC) on the xenograft tumor model. (x¯±s, n =7) (a) The photographs of tumors dissected from PC mice. (b) The tumor volume. (c) The tumor weight. (d-f) The semi-quantitative score and typical picture of Hematoxylin-eosin staining in the lungs and livers. (×400) (g-i) The Bax and Bcl-2 protein levels in the lungs of PC mice. (j-m) The p-AKT/AKT, PTEN, TFAP2A levels in the lungs of PC mice (n =3). ##P <0.01 compared to the Exo + miR-NC group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.